KEGG   Yersinia pestis D182038: YPD8_2231Help
Entry
YPD8_2231         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K19127  
CRISPR-associated protein Csy1
Organism
ypx  Yersinia pestis D182038
Brite
Prokaryotic defense system [BR:ypx02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-F factors
    YPD8_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2845254..2846600
Genome map
AA seq 448 aa AA seqDB search
MSDEGLAAFIVSYIKSREQPKLEAFDKEAEKRLAGLTQAEDIALAQQEIAQQRQELIARY
EVRNWLTDAANRAGQIKLATHAPKYTHSDSKSSGILNIELQSKKKDYFSSVDLAEQASDV
IGNAAVFDLVKLLQSECEGGSLIKCLEQGDNSVLKLFSNDDELVEEWTTKFKSILNNEKF
TSHKLAKQFYFPVGPDQYHLLSPLFSSSLAQAMHQRIIEARFSDQSKEAKAAHKAGRWHP
TVRVLYLDTAVQHIGGTKPQNISYLNSVRGGKVWLLPCGAPSWKNIQKPPIKYRSIFHDR
SEFTVLARNNLWQMQLYLLGVKPLSNTMDIRAARLACCDEIIDILFNYVAEIQNLDGTNG
WSDAEDCKLKRSEQLWLDPTRAMDDPVFKLEREKEDWKQEVSQDFGYWLNRWLQHDELVF
GYVEQREWSSLFKQRLREFEQGSLETSS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgaaggattagcggcgtttattgtctcttatatcaaaagccgcgagcagcca
aagcttgaggcttttgataaagaggcagagaaaaggctggcagggctaactcaggcggaa
gatattgcactggcccagcaagagattgcccaacaacggcaggagttgatagcccgttat
gaggtgcgcaattggttaaccgatgcggctaaccgtgccgggcaaataaagttagcaact
catgcacctaaatacactcatagtgattcaaaaagtagtggtattttgaatattgagtta
caaagtaagaaaaaggattatttctccagcgtagacctcgctgaacaagccagtgatgtt
attggtaatgcagccgtatttgatcttgtaaagctattgcagagtgaatgtgaaggcggc
tcattaataaagtgtttagagcaaggtgataattcagtactgaaactattctcaaatgat
gacgagttagttgaagagtggactacaaaatttaaaagcattttgaataatgagaaattc
acgtcacataaactggccaagcaattttatttccctgtggggccagatcaataccacttg
ttaagtccacttttctcctcatcattggcgcaggccatgcatcaacgtattattgaagcc
cgtttcagtgaccaatcgaaagaggccaaggctgcccataaagcagggcgatggcatcct
acggtcagggtcttgtaccttgatacggcggtgcaacatattggtggtaccaaaccccaa
aatatctcttacctaaacagcgtccgtggcggaaaagtttggttgctgccctgtggcgca
ccgtcttggaaaaatattcagaaaccgccaataaaatatagatctatttttcatgatcgc
agtgaatttactgtactggcccgcaataacctgtggcaaatgcagctatatttgctgggt
gtcaaacccctgagcaatacgatggacatccgcgccgctcgtttggcctgctgcgatgaa
atcattgatattctgtttaattatgtggctgaaattcaaaatctggacggtaccaatggc
tggagtgacgctgaagattgtaagttaaaacgctcagagcagctttggcttgacccgacc
cgtgctatggatgaccccgtatttaagctcgaacgtgagaaggaggattggaaacaagag
gtcagccaagacttcggttactggttaaatcgttggttacagcatgatgaactggtcttt
ggctatgttgaacagcgggagtggtcaagcttatttaagcagcggctacgtgaatttgaa
caaggtagcctggagacatcgtcatga

DBGET integrated database retrieval system