KEGG   Yersinia pestis D182038: YPD8_2232Help
Entry
YPD8_2232         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K19128  
CRISPR-associated protein Csy2
Organism
ypx  Yersinia pestis D182038
Brite
Prokaryotic defense system [BR:ypx02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-F factors
    YPD8_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2846597..2847547
Genome map
AA seq 316 aa AA seqDB search
MSSLIVLHQVRVENANAIAGLTYGFPAITHFLGYSHALSRKLQSSHGLTLRGCAVICHYQ
QVHAYLSGWDYVFSLTRNPLTKEAKTAAFNEEGRMHMTVSLVIECDGTIANGDDGANALE
KHLASLCLTQRLAGGTITNIRRVKVINYPETEVATRRLLCRLLPGFALLDRSELLAEHLN
RLRQTNPQAEMLDAWLDFSALKIQAIPPQSDTPVESGAPAPWGYVGKPAAGYLVPIVTGY
RAISPLYAPGEVDKTRDPHTPFRFVESLYGIGEWRGLHRITDLRQLLWGYHQEGDNYLCR
CALPASVDTYLLNDEE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagctcactgattgttttacatcaggtgcgcgttgagaacgccaatgccatcgcgggt
ttaacttatggtttccccgcgatcacccattttctgggctacagccatgcgttatcacgt
aaattgcaatccagtcacggtttaacactacggggttgtgccgttatctgccactaccag
caggttcatgcttatctctctgggtgggattatgtcttctcgctaacgcggaatccactc
actaaagaggccaaaaccgccgcctttaatgaagagggccgtatgcatatgacggtgtct
ctggtgattgaatgtgatggcacgattgctaatggggatgacggtgctaacgcgctggaa
aaacatctggcgtcactgtgcctgactcagcgtttagccgggggcactatcaccaacatt
cgcagagttaaagtcattaattatcctgaaaccgaggtcgccacacgcagattattgtgc
cgcttactgccaggttttgcgttactggatcgctctgaattgttggctgaacatcttaac
cggctaagacaaaccaatccacaggcagaaatgctggatgcctggctcgatttctccgcg
ctcaaaatacaggccattcccccgcagagcgatacgccggtggaaagcggtgctcctgca
ccgtggggttatgttggtaagccagcagcagggtatttggtccccattgtcactggttat
cgtgccatttcaccgctgtatgcgccgggtgaagtggataaaacccgtgacccgcatacg
ccgttccgctttgttgaatccctttatggcatcggtgagtggcgcgggttgcaccgtata
acggatctgcgtcaattgctctggggctatcaccaggaaggcgataattacctctgtcgc
tgtgcactcccggcatcggttgatacctatctattaaatgatgaagaataa

DBGET integrated database retrieval system