KEGG   Yersinia pestis D182038: YPD8_2233Help
Entry
YPD8_2233         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K19129  
CRISPR-associated protein Csy3
Organism
ypx  Yersinia pestis D182038
Brite
Prokaryotic defense system [BR:ypx02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-F factors
    YPD8_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2847565..2848569
Genome map
AA seq 334 aa AA seqDB search
MAKATIKTASVLAFERKLSNSDAMMYAGNWGQTDNWQPIIIKEKAVRGTISNRLKNALAS
DPAKLDAEIQKANLQRVDVAALPFDTDTLKMSFTLRVLGNLATPSVCNDQEYQAELASVI
NGYISEQSFSVLAARYAENLANGRFLWRNRVGAEDIKVCITSQTKSYQFDSNEFSLRQFS
QPSKELTALAQEIEQGLAGNGFAFFTVDAFVRLGNGQEVFPSQELVLDSNSKKSKVLYQI
DGIAALHSQKVGNALRTIDDWYPDATELALGPIAVEPYGSVTSRGKAYRQPKQKMDFYTL
LDNWVTKGTVPAVEQQHYVMATLIRGGVFGEKGE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaacgattaaaaccgcttctgtactggcatttgaacgtaagttatccaat
tccgacgccatgatgtatgccggtaactgggggcaaaccgacaactggcagcctatcatc
attaaagaaaaagcggtgcggggcaccatctccaaccggttgaaaaatgccctggcatct
gatccggcaaaactggatgcagagatccaaaaagcaaacttacaacgtgtggatgtggcc
gcactgccgtttgatactgacaccctgaaaatgagttttacactgcgggtgctgggcaac
ctcgctacgccatcagtatgtaatgatcaggaatatcaggctgaactggccagtgttatt
aatggctatatcagtgagcagagttttagtgtgctggcggcgcgctatgccgagaatctg
gctaatggccgtttcttgtggcgcaaccgggtcggggctgaagatattaaagtgtgtatc
accagccaaacgaagagttatcaatttgatagcaatgaatttagcttgcgtcaatttagc
caacccagcaaggaactgactgcgctggcacaagaaatagaacaaggtttagcgggcaac
ggttttgcctttttcaccgttgatgcttttgttcgtttaggtaacgggcaggaagtgttc
ccgtctcaggagttggtgctggacagcaacagtaagaaaagcaaagtgttatatcagatt
gatggtattgcggccctgcattcacagaaagtgggtaatgcgttacgtaccattgatgat
tggtatccagatgccactgagttggctttggggccgattgccgttgaaccctatggctcg
gtgaccagccggggtaaagcctatcggcagccaaaacaaaaaatggatttctacacctta
ttggacaactgggtgacaaaaggcacggtaccggcggtcgaacagcaacattatgtgatg
gcaaccttgatccgtggtggtgtctttggtgagaaaggcgaataa

DBGET integrated database retrieval system