KEGG   Yersinia pestis D182038: YPD8_2237Help
Entry
YPD8_2237         CDS       T01833                                 

Definition
(GenBank) putative transporter protein
  KO
K08368  
MFS transporter, putative metabolite transport protein
Organism
ypx  Yersinia pestis D182038
Brite
Transporters [BR:ypx02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    YPD8_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2850792..2852150)
Genome map
AA seq 452 aa AA seqDB search
MQTLPSEKIRMDDVPLNRFHIRIAGLTFGAHFIDGYILGLIGFALIQLKPIMALTPLWEG
LLGSAALIGLFLGSLILGWISDYIGRQKIFSFSFVIITLASALQFFASTPEQLFILRVIV
GIGIGGDYSVGHTLLAEFSPRKHRGVLLGAFSVIWTFGYVSASFVGHYLSMVSPEAWRWL
LSSAALPALLILLVRIGTPESPRWLMGKGREDDAMAIVHKYFGPNVTLIDEEPATSTRRF
LSLFGRKYWRRTAFNSLFFVCLVIPYFAIYTFLPSILNVMALSQNFATDLLLNGLLVVGA
LVGIVLTAFCSRRSFLISSFIFLATCLLLLSILPSNQTFWLIALFAAFTLVMSAVSNLVG
VFPAESFPTEVRSMGVGFATSMSRLGSAIGTSLLPLAIVNYGMPVTTTLLAFVLIIGAIV
SIAWAPETKGLTLVDASQSATTPRPPSSIIPN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacattaccatcagaaaaaatcaggatggacgatgtccccctaaatcgcttccat
ataagaattgccgggctaacttttggcgcacactttatcgatggctatatcttaggtctg
attggctttgcattaattcaactcaaacccataatggcacttacaccattatgggaggga
ttactcggatcagccgcgctgatcgggctatttctaggcagcctaatattaggctggatc
tcagattacattggccgccagaaaattttcagtttcagttttgtcatcattaccttagcc
tcagcactgcaattttttgccagtacaccagaacagttatttattttgcgggtcatcgtt
ggtattggtatcggtggcgattactcggtgggacatactttattagctgaattttcacca
cgaaaacatcgcggggtcttattgggcgcattcagtgtcatttggacctttggctatgtg
agtgccagtttcgttggacattatctgagtatggtcagccccgaggcttggcgttggttg
ttatcttctgccgccctgcccgctttacttattctccttgtacggattggtacgccggag
tcaccgcgctggctaatgggaaaaggtcgtgaggacgatgccatggccattgtgcataag
tactttggcccgaacgtaacgttgattgatgaggaacccgcgacttccacccgccgtttt
ctgtctttatttggccgtaaatactggcgacgtaccgcttttaatagcttattttttgtt
tgtctggtgatcccctacttcgcgatctatacctttttaccctcgattcttaacgtgatg
gcgttgagccagaattttgctaccgacttgttattgaacggcttgctcgtggtgggtgct
ttagtcggtattgtcctgactgcattctgctcgcgccgtagcttcctgatctcttccttt
attttcctggctacctgcctactcttgctgagcatactgccttccaatcaaacattttgg
ctgattgcactcttcgcggcttttactcttgtgatgtctgccgtcagtaacctagtcggt
gtgttcccggccgagagtttcccgaccgaagtacgctcaatgggggtgggatttgcgact
tccatgagtcgcttgggatcagctattggtaccagcctgctgccattagccattgtcaat
tatggaatgcccgtaaccaccaccctcttggcattcgttttaattattggagccatcgtt
tctatcgcttgggcaccggaaacgaaaggactcaccctcgttgatgcctcacaatcagca
accacaccacgcccaccgtccagcattattccaaactga

DBGET integrated database retrieval system