KEGG   Yersinia pestis D182038: YPD8_2241Help
Entry
YPD8_2241         CDS       T01833                                 

Definition
(GenBank) membrane protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2855816..2856493
Genome map
AA seq 225 aa AA seqDB search
MDRSPSLFTSKKFVFFGATFCCLLWGSAYPAIKNGYQLFNISPDDIPSKMVFAGYRFLLA
GLVLLLFALASGKAIGRLKKGQYQQIAILGLTQTALQYVFFYIGLAYTTGVKGSIMNATG
TFFSVLLAHYLYKNDRLTLNKIIGCALGFVGVMVVNVGSDLMDFNFSLLGEGSVVLAAFI
LSAASIYGKRISQTMDTTVMTGYQLAIGGLVLTLGGYLFVFGLGQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcagtccttctctttttacgagtaaaaagtttgtcttcttcggtgcaaccttc
tgttgtctactttgggggagtgcctatccggcaataaaaaatggctatcaattgtttaat
atttcgcctgatgatattcccagtaagatggtgtttgctggatatcgttttttattagcc
ggattagtattgctgctttttgcgctcgccagtggtaaggcaatagggcgtcttaaaaag
ggacaatatcagcaaattgctattttgggattaacccaaacggcgttgcagtatgtgttt
ttttatatcggtttggcttacaccactggagtgaaaggttcaatcatgaatgcgacgggg
acattcttcagtgtcctgctagcacattacctctataaaaatgaccggttaacgttgaat
aaaattattggctgcgctctgggttttgtgggggtgatggtggtcaacgtgggttcagat
ttaatggacttcaatttttcgctgctcggagagggctcggtagtattagccgcatttatt
ctctccgcggccagtatttacggtaagcgcatttcgcagacgatggataccacggtgatg
accggctatcagttagcgattggtgggttggtgttaacccttgggggctatctatttgta
tttggtcttggtcagtag

DBGET integrated database retrieval system