KEGG   Yersinia pestis D182038: YPD8_2242Help
Entry
YPD8_2242         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K07146  
UPF0176 protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2857544..2858611
Genome map
AA seq 355 aa AA seqDB search
MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYV
AKEGINAQISVPANRYDEFKIALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVAD
GIDDDSFDPANIGHYLKADQVNQMIDDPDTLFVDMRNHYEYEVGHFENAIEVPSDTFREQ
LPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGL
PLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFE
GCCSQICQEELKLPQEEQRSRRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgttacataaccgaatttctaatgaggaactcaaagcgcgtatgttggctgaa
accgagccgcgcaccacagtttctttttataaatacttcactctggaagatgctaaaacc
ttccgtgataacctctatagccaatttgttaagctcggtgtttttggccgcgtctatgtg
gcaaaagagggtatcaatgcacagatcagcgtccccgcgaatcgatatgatgaatttaaa
atcgcgctgtttgcctcacaccctgcgctggatcaagtacggttgaatgttgcgcacgaa
gatgacggtaaatcattttgggttttgcgcctgaaagttcgtgagcgcattgtggctgat
ggcattgatgatgacagctttgatcctgccaatatcgggcactatctgaaagccgatcag
gtcaatcagatgattgatgatccagatacgttgtttgttgatatgcgtaaccactatgaa
tacgaagtgggccattttgaaaacgcaatagaagtcccttcggatacattccgtgaacaa
ctgccgatggcggttgatatgctgcaacatgataaagagaagaatattgtcatgtattgc
accggggggatccgttgcgagaaagccagtgcttatatgctgcacaatggcttcaaaaat
gtttatcacgttgaaggcggcattattgaatatgcacgtaaagcaaaagagcaggggcta
ccactgaaattcatcggcaaaaattttgtgttcgatgaacggatgggggaacggatttct
gatgatgtcatagcgcactgccatcaatgtggaacgccttgtgacgcgcataccaactgt
aaaaacgatgggtgccacttactgtttatccagtgtccagtgtgcgcggcgaagtttgaa
gggtgttgtagccagatttgccaggaagagctgaaactgccacaggaagagcaacgctcc
cggcgggcagggcgtgaaaatggcattaagatttttaataagtctaaagggttgttgcaa
gccaccatgcacattccctcgccagaaaagagtgcggatgaaaagtag

DBGET integrated database retrieval system