KEGG   Yersinia pestis D182038: YPD8_2244Help
Entry
YPD8_2244         CDS       T01833                                 

Definition
(GenBank) putative LuxR-family regulatory protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2860390..2861004)
Genome map
AA seq 204 aa AA seqDB search
MKILIIDECFYTRSGVNTYLNSVSSIKLMDVPTVEEATLAIQEFQPDIIIVNLTQYCRYG
GHCPLLAQFIHYCTRAKVYIYLDASYPFSETPIPLTESVSMPIPLTESVSILAKKHLPNL
LRRLPGFSLERLGIQPNQQASLFSPQEHKVMCYWMTEMPNYRIARKLNISGSTVYSHKRH
ITEKIKVRNRLELCFIYNVFKYLY
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaatcatcgacgaatgcttttatactcgttctggagtcaatacctatttg
aatagtgtctcatctataaaattaatggatgtccctaccgttgaagaggcaactttagct
attcaagaatttcagccggatataattattgttaatttaactcaatattgtcgctatggt
ggtcattgtccattgttagcgcaatttattcattactgtacccgagctaaagtttatatc
tatttagatgcttcttacccttttagtgaaacgcctattcctctgacagaatccgtatca
atgcctattcctctgacagaatccgtatcaatactggctaagaaacatctacccaattta
ctccgcaggttacctggtttctctcttgagaggctaggcattcagccaaaccaacaggct
tccctgttcagtccacaagagcacaaagtgatgtgttactggatgacagagatgcctaac
tatcgcattgccagaaagctaaatatcagcggcagtacggtttactcacataaacgtcat
atcaccgagaaaataaaagtcaggaatagattggaattgtgtttcatttataatgtgttt
aagtatttgtactag

DBGET integrated database retrieval system