KEGG   Yersinia pestis D182038: YPD8_2249Help
Entry
YPD8_2249         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2868365..2869243)
Genome map
AA seq 292 aa AA seqDB search
MRIPTLMATKRLLQNILMALFLLALLVIGFRLWPHPPLSQGLPLSTAYYDRHGTLLRLSL
ANDDRYRLWTPLEEISPLVIQGIQLHEDRGFYYHPGVNPISLLRGFWQSYVQGGRQQGGS
TLTMQLARMHWHLNTRSPTGKLRQIARAIQLELSYSKHDILEAYLNYAPYGRNIESIAAA
SLIYFDKKPQQLTLPEALTLAVLPQSPSYRIDPTTGVLGSALTQARNRLFVRWQQTYPTD
SSQMALFQLPLSLRQPEKMPYIAPHFIEQIRRQNQQLANTRDCKQYCVIACF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcccaaccttaatggcaaccaaacgcctgttgcaaaatatcctgatggccctc
tttctgttggccctcttggtcatcggctttcggctgtggccacacccgcccttgtctcag
gggctcccactctctacggcttactatgatcggcacggcacgctattacgtctttcgctg
gctaatgatgatcgttatcgcctgtggacaccgttggaagagatctccccattggtgata
cagggtatccaactgcatgaagaccgcggtttctattatcatcccggtgttaatcccatt
agcctgttacgcgggttctggcaaagctatgtacaaggcggcaggcaacagggcggttca
accctgaccatgcagttggcacggatgcactggcatctcaatacccgttcgccaacaggt
aaattgcgacaaatcgcccgagctatccaactggaactgagctattccaagcacgatatt
ttagaggcttacctgaattacgccccttatggccgtaatatcgaaagtattgccgctgcc
agcctgatttattttgataaaaaaccccagcaactgacgctgccagaagccctgacattg
gcggtattgccccaatcgcccagttaccgcattgatcccaccaccggtgtgctggggagc
gccctgacccaagcccgtaaccggctattcgttcgctggcaacaaacgtaccccaccgat
agcagccaaatggcgctattccagttaccgctcagcctgcgtcaacccgaaaaaatgccc
tatatcgcgccacattttattgaacagatccggcggcaaaatcaacaactggcgaatacc
cgagactgtaaacaatattgtgtaattgcctgtttttga

DBGET integrated database retrieval system