KEGG   Yersinia pestis D182038: YPD8_2253Help
Entry
YPD8_2253         CDS       T01833                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ypx  Yersinia pestis D182038
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPD8_2253
   00562 Inositol phosphate metabolism
    YPD8_2253
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPD8_2253
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPD8_2253
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     YPD8_2253
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     YPD8_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2878027..2879553
Genome map
AA seq 508 aa AA seqDB search
METVANFINGKCVFSCGNSVTSGSPRAQAIFNSATGEPIRQVMMSTAQETEQAITAAQQA
FASWSRQAPLKRARVMFRFKSLLEQHLDALAQLISEEHGKVYSDAVGELTRGLEVVEFAC
GIPHLQKGEHSANVGTGVDNHSLMQPLGVCVGITPFNFPAMVPMWMFPIALATGNTFVLK
PSEKDPSLAVRLAQLLTEAGLPDGVFNVVQGDKTAVDVLLTDPRVQAVSFVGSTPIAEYI
YQTASAHGKRCQALGGAKNHCILMPDADMDMAASAIMGAAYGAAGERCMALSVVLAVGDE
TADNLCARLEQQISTLRVGPGLAQEPENDMGPLISAPHRAKVLGYIDSGVAQKATLRIDG
RGLKVAGHEQGYFVGPTLFDHVTPAMTIYQEEIFGPVLSVVRIADYRSAVDLINRHEYGN
GTAIFTRDGGTARRFCEEVQVGMVGVNVPIPVPVAFHSFGGWKRSIFGPLNVHGNDGVRF
YTRMKTITARWPEAQHDQGAAFSMPTLG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtagcgaattttattaatggcaaatgtgtctttagttgcggcaacagtgtc
accagcggtagcccgcgcgctcaggcaatcttcaactcagccactggcgaacctatccgt
caggtgatgatgagcacagcgcaggagaccgagcaggccatcacggcggcacaacaagcg
ttcgccagttggtcgcgccaagcgccacttaaacgcgcgcgcgtgatgttccggtttaaa
agtttgctggagcagcatctggatgcattggcacagcttattagcgaagagcatggaaaa
gtgtattccgatgcggtgggtgagctaacccgaggtctggaagtggtggaattcgcctgt
ggcattccgcacctccaaaaaggcgagcactcagccaatgttggcactggcgtggacaat
cactcgttgatgcagccgctgggggtgtgcgtggggattacgccctttaatttccccgcg
atggtaccgatgtggatgttcccgatagccctggcgaccgggaatacttttgtactgaaa
ccgtccgaaaaggatccgtcgctggctgtgcggctggcacaacttttaaccgaggccggg
ctaccagacggtgtatttaacgtcgtacagggtgataaaaccgcagtggacgtgctgttg
accgatccgcgagtgcaggcagtaagctttgtcggttctacgccgattgctgaatatatc
taccagaccgcatcggcccacggaaaacgctgccaggcactgggcggggccaaaaaccac
tgcattctgatgccggacgccgatatggacatggcggctagcgccattatgggcgcggca
tacggcgcggcaggggagcgctgtatggcgctctcggtggtgttggcggtgggggatgaa
acggcagataacctttgcgcacggctggaacagcaaattagcacgttacgtgttggtccg
gggctggcacaggagccagaaaacgacatggggccgctgatctctgcgccacaccgcgcg
aaggtattggggtatatcgacagcggcgtggcccagaaggcaacgttgcgcatcgatggc
cgtggtttgaaggtggcgggccatgagcaagggtattttgtcgggccaacgttgttcgat
catgtcaccccggccatgaccatttatcaagaagagatttttggaccggtactttctgtg
gtacgtatcgcggattatcgcagtgcggtggatctgatcaaccgtcatgaatatggtaat
ggcacggctattttcacccgcgatgggggtaccgcacgccgcttctgtgaggaggtacag
gtggggatggtcggcgtcaacgtgccgatcccagtaccggtggcgtttcatagcttcggc
ggctggaaacgttcgattttcgggccgctcaacgtgcatggcaatgacggggtgcgcttc
tacacgcggatgaaaaccatcactgcccgctggccagaagcacagcatgatcagggcgcg
gcattctctatgccgacactcggttga

DBGET integrated database retrieval system