KEGG   Yersinia pestis D182038: YPD8_2304Help
Entry
YPD8_2304         CDS       T01833                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypx  Yersinia pestis D182038
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPD8_2304
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YPD8_2304
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPD8_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2942642..2944582
Genome map
AA seq 646 aa AA seqDB search
MKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALELSALPKPASDAIQQRFELLGLALS
ATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEVIGFDQVGVFYGLQSILSLVPIEGS
KTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRLLDQMSAYKLNKFHFHLSDDEGWRI
EIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESNNLGSGYFTRADYIDILKYAKARQI
DVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEANEFRLVDPTDDSNTTSVQFYERKSY
LNPCLDSSKHFVDKVIGEMAKMHKEAGMPLTTWHFGGDEAKNIRLGAGYQDKNGKIEPGK
GIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSYFAIEVSKLVNAHGIEKMQAWQDGL
RDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVIASNPDYVYFDMPYEVNPSE
RGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGNHFSAKSDKPWPGVQGISGQSWNET
VRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGREYKGGETQWVDTQALSTDWQRFAN
IMGQRELAKLDKAGVAYRLPVPGGQSGGGAVGSQYFLARPPYRVLH
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacactctctgcggctaacctgcgtgggcagattatcccaacaccactggacgtt
aaggtttatccgcaagatgccgatctgagcctcggtgtggcgctggaattgagtgcgcta
cccaaaccggcctctgatgccatacagcaacgttttgaattgctgggcctggcgctaagc
gcgacgggctatccgattaaaacagtgattcagccaacggccttcaacggggatcacgct
gtttccggtgcgtatgaactgaaaattggtgagaagggcgcagaggtgattggttttgat
caggtcggtgtattctatggcctgcaatctatcctttccttggtacctattgaggggagc
aaaacaatagccacccttgatgcgaaagatgcgccacgctttgactaccgtggtgtctcg
ctcgatgtggggcgtaacttcaaaaccaaagcggcggtcctacgtttattggatcaaatg
tctgcttacaaactgaataaattccacttccatctgagtgatgatgaaggctggcgcatt
gagatccctggcctgcctgaattgaccgatgtcggcagccagcgttgccatgatttgact
gaaaccacctgtttgctaccacagctaggctctggccctgagagcaataatctggggagc
ggttatttcactcgcgctgattacatcgatattctgaaatatgccaaagcgcgccagatt
gatgtcattcctgagatagatatcccggctcacgcccgtgctgctgtggtatcgatggaa
gcgcgttataacaatttgatgaaacagggtaaagagaaagaagccaatgaattccgtctg
gttgatccgaccgatgactcgaataccacatcagtacagttctatgagcgtaaaagttac
ctgaatccctgcctggactcttctaagcattttgtcgacaaagtcattggtgaaatggcg
aagatgcacaaagaggccggtatgccgctgaccacctggcatttcgggggcgatgaggcg
aagaacatccgtctgggggcgggttatcaggataagaatggcaaaattgagccaggtaaa
ggcatcatcgatatgcgcgttgaagataaaccgtgggcgaaatctcaggtttgtcaggac
atggtcaagcaaggcaaagttcaagatattgctcatctttccagctacttcgccattgaa
gtcagcaaactggttaatgcgcacggtatcgaaaaaatgcaggcctggcaggatggactg
agagatgccaaagatgcgagcgcgtttgctaccaagcgtgttggcgtcaacttctgggat
accctctactggggcggagcggactccgtcaacgattgggccaataaaggttatgaagtc
attgcctcgaatccagattatgtctacttcgatatgccgtatgaagttaacccaagtgaa
cgcggttactactgggcgacgcgctttagcgatgaagccaaggtgttcagcttcgcacct
gacaacatgccacagaacgccgaaacctcggttgatcgcgatggtaatcatttcagtgcg
aagagtgataaaccctggccgggtgtacagggtatctccggtcagtcttggaatgaaacg
gtacggactgatgagcagatggagtacatggccttccctcgtgtattaccgctggctgag
cgtgcatggcatcgcgcatcctgggagcaggagtataaagcggggcgtgaatataaaggt
ggcgagactcagtgggtcgatactcaggcattaagcacggattggcagcgtttcgctaac
attatggggcaacgtgaactggcaaaactggataaagcgggtgtggcttaccgcttgcca
gtaccggggggccagagtggtggcggggcagttggaagccaatatttccttgccaggcct
ccttatcgagtactccactga

DBGET integrated database retrieval system