KEGG   Yersinia pestis D182038: YPD8_2694Help
Entry
YPD8_2694         CDS       T01833                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypx  Yersinia pestis D182038
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPD8_2694
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPD8_2694
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPD8_2694
Lipid biosynthesis proteins [BR:ypx01004]
 Fatty acid synthase
  Component type
   YPD8_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3415808..3416443
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDMSEI
INQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWM
QDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggattattc
agtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggt
taccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacg
ccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggcta
gcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactgggc
gccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatatgagcgaaatt
atcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccct
aactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacag
ttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatg
caggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcg
caacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system