KEGG   Yersinia pestis D182038: YPD8_2694Help
Entry
YPD8_2694         CDS       T01833                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypx  Yersinia pestis D182038
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ypx01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3415808..3416443
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDMSEI
INQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWM
QDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggattattc
agtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggt
taccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacg
ccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggcta
gcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactgggc
gccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatatgagcgaaatt
atcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccct
aactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacag
ttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatg
caggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcg
caacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system