KEGG   Yersinia pestis D182038: YPD8_2728Help
Entry
YPD8_2728         CDS       T01833                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypx  Yersinia pestis D182038
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPD8_2728
DNA repair and recombination proteins [BR:ypx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      YPD8_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3457371..3457946)
Genome map
AA seq 191 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEHCT
ICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGPGDIGLDLLEK
RLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGELEMVDGTTLS
HSLAGRNPIKY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgttgcgttgtttaccgggtgttggcccgaaatcggcgcaacgtatggcattt
cagctattacagcgcgatcgtagtggtggaatgcgcctggcgcaggctctgacacgggca
atgtctgaaataggccattgtgcagattgtcgtacatttaccgagcaagagcactgcacc
atctgcttgaatccccgccgtcaacaaaatggtcaaatctgtgtggtcgaaagcccggca
gatatccatgccattgagcaaactggccagtttggcgggcgttattttgtgctgatgggg
catttatcacctatggatggtattggccctggtgatatagggctagatctactggagaaa
cggctttctactgaggctatcagtgaggtcattttagccacgaatccaaccgttgaaggg
gatgcaacagccaactatatcggccagatgtgtggccaatatggcatactggccagccgc
atcgcccatggcgttcctgttggtggcgagttagaaatggttgatggcaccacgttatct
cactcgttagcagggcgtaatcccatcaagtactga

  All links  
No link information was found.   
DBGET integrated database retrieval system