KEGG   Yersinia pestis D182038: YPD8_2927Help
Entry
YPD8_2927         CDS       T01833                                 

Definition
putative cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ypx  Yersinia pestis D182038
Brite
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     YPD8_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3705808..3707187
Genome map
AA seq 459 aa AA seqDB search
MIRRGLIGGGILVIAGYLGIAGYLYMTDNTRNNTFISEAKTPNQQVSNILYQKGCDYCHT
ANASLPFYAAIPGPKQLMDYDIRQGNQHFSLEPTLLALKENRAVPEADLAKIESAIARDQ
MPPQRFNALHWSSSINAEERNQILDWVKIQRTTYFPSNSHSEMQHLALQPIPDALLVDNQ
KVALGSRLFHDPRLSGDNSISCASCHLLNKGGVDNLATSTGVDGQKGGINAPTVFNAVFN
VEQFWDGRAVDLQQQAGGPPLNPVEMASTSWEDIIAKLQQDPQLTQDFAQVYPQGYSEDT
ITDAIAEFEKTLTTPNSPFDHYLKGETQALTTSQQKGLALFQQNKCDTCHVGKNIGGQSY
EFLGLKSDYFADRQKEQTTDDLGRFNVTNDPRDMHRFKTPSLRNIALTAPYFHDAQAKDL
HQAVELMLKYQVGTQLPEQDINDIVAFLESLTGEYIPHS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaagaggattaattggtggcggtatattggtaattgcaggttatctgggtatt
gctggctatctttatatgacagataacacacgtaataacaccttcatcagcgaggcaaaa
acacccaatcagcaggtcagtaatattctttaccaaaaagggtgtgattattgccatacc
gcgaatgcatccctgccattttatgccgctatccccggccctaaacaactgatggactat
gacattcgacaaggtaaccagcatttctcattggagccaacactattagcattaaaagaa
aatcgtgccgttcctgaagcagatttagccaaaatagaatcggctattgctcgcgatcaa
atgccacctcaacgctttaacgcattacattggtcctccagcatcaacgctgaggagcga
aaccagatccttgattgggtcaaaatacaacggacgacatacttcccttccaatagccac
agcgaaatgcagcacttagcactacagccgatccccgatgccttgctggtcgacaaccaa
aaagtggcactaggttcccgcctgttccatgaccccagattatccggtgataactctatt
tcctgtgccagttgccatctgttgaacaaaggaggcgttgataatctggcgacctcaacg
ggtgtcgatggacaaaaaggtgggatcaacgcgcctacggtatttaatgccgtatttaac
gtggagcagttttgggatggccgtgccgttgatttgcagcaacaagccggtggaccacca
cttaacccagtagaaatggcctcgacctcttgggaagatataattgctaaattgcaacaa
gacccacagttgacccaggactttgcccaagtgtatccgcaaggctattctgaagacacg
atcaccgatgcaatcgctgaatttgagaaaaccctgaccacccccaacagccctttcgac
cactatctgaaaggtgaaacacaggcattaacgactagccagcaaaaaggcttggcgcta
ttccagcaaaataaatgtgatacctgccacgtcggtaaaaatattggtgggcagtcctat
gagttcttggggctaaaaagtgactatttcgctgatcgccaaaaagagcaaactaccgat
gacctcgggcgtttcaacgtcaccaacgatccacgcgatatgcaccgctttaaaacaccg
agcttgcgtaatattgccttaacagccccttattttcacgatgcacaagctaaagattta
catcaggcggttgagctaatgctcaaatatcaggtagggacccaactaccagaacaggat
atcaacgatatagtggccttcctggaaagtttgaccggggaatatattcctcattcctga

DBGET integrated database retrieval system