KEGG   Yersinia pestis D182038: YPD8_3226Help
Entry
YPD8_3226         CDS       T01833                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypx  Yersinia pestis D182038
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPD8_3226
Enzymes [BR:ypx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPD8_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4070875..4071804
Genome map
AA seq 309 aa AA seqDB search
MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGVV
GDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPAL
VDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDYL
TPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPCI
IDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDAF
MRSITVKEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgtatt
cctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaaggc
tcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtcgtc
ggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaatatc
gacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagataaa
gaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcgttg
gtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaaatt
ccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataaccatc
ctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattatttg
acccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgcagc
aaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacgctg
ggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgcatc
attgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtcgcg
ctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcgttg
tgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgctttt
atgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system