KEGG   Yersinia pestis D182038: YPD8_3377Help
Entry
YPD8_3377         CDS       T01833                                 

Gene name
pldB
Definition
putative lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ypx  Yersinia pestis D182038
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ypx00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4270889..4271902)
Genome map
AA seq 337 aa AA seqDB search
MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFRAPHHTQVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVIKFDDYIEDFA
QLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFGIHLPLPGWLAR
RIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTY
HWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGRPQ
VIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaggtcatcacatgaataattggttaacccgagaagagcaatttgctgctttt
attaatgggccattgttggatttctggcagcaacgagacgaacagacgtttatgggcgtc
gataatatccccattcgctatgtccgttttcgtgcgccgcatcatacccaagtcgtggtg
gtagtgccggggcgtatcgaaagttacgtcaaataccctgaagttgcttatgacctgttc
cagcagggctatgatgtgatagtgctggatcatcgcgggcaagggcgttctgggcgtatg
ctggatgatcataaccgtggtcacgtgattaagttcgatgactatattgaggattttgca
caactggtgcagatcgaaattaccggtagccattatcagcagcgttttgcgctggcccac
tcaatggggggcgcgattctgacgcgttttctagccagagagcctgatgtatttaatgcc
gttgcgttatgtgcgcccatgtttggtattcatttacccctgccgggctggttggcacgc
cgtattgttaactgggccgaagggcaccaaaagctacgggattattacgcgattggtact
gggcattggcggccactgccgtatttggtcaatatgctgactcacagccgcgagcgttat
cgccgctatttgcgccaatattcagacacaccagaaatccgcgtgggtggccccacttac
cattggctacgtgaaagtttgctggtgggggagcaaattattgctgaagcggagaaaatc
accactccggtattattgttacaggccagtgaggatcgggtggttcataacccagcccac
gatgctttttctcaggcaatgacattggcagggcacccctgtgaaggggggcgtcctcag
gtcattcaaggcgcacgccatgagatcctgtttgagcgggacacgctgcgtgccgaggcg
cttagcgccatattgcgctttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system