KEGG   Yersinia pseudotuberculosis YPIII: YPK_0093Help
Entry
YPK_0093          CDS       T00665                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPK_0093
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPK_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
108109..109224
Genome map
AA seq 371 aa AA seqDB search
MVVMFKHLASMFLLLASFSLAATSNWPAWQQFKQDYISEGGRIIDPGSPSKITTSEGQSY
GLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADI
LIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLN
PSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDWVVWQKGKGWQPDTIKPDV
GSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGSVG
FSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQ
GELQPSWHRQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatgtttaaacacttagccagcatgttcctgttgctggccagttttagtctc
gcagccaccagtaactggcccgcgtggcaacagttcaaacaagattacatcagtgaaggg
gggcggatcattgaccccggtagcccctcgaaaataaccacctcggaaggccagagttat
gggcttttttttgcattggttgcggatgatcagccgatgtttgagcgtttattggcttgg
acagaaaacaatctggcagccggtgatctcacttcccgccttcccgcttggttatggggg
caaaactcacaaaataactgggatattctggaccctaattcggcctccgatgcggatatc
ttgattgcctacaacttgctggaggctggcaggttatggggtaaccgccgttacctgatt
atgggtaccttattactgcaacgtattgcgcaagaagaagtcatggatattcccggcctt
ggccagatgctattaccgggaaaaattggttttaacgatgaggatacctggcgtctcaac
ccaagttatttaccgccacaactactggcacgattttcctccatagacgggccttgggaa
gcgatggtagaagtgaatcagcgtatgtggctggaaaccgcaccaaacggtttttcgccg
gactgggtggtctggcagaaaggtaaaggctggcagcccgataccataaaaccggatgtc
ggcagtaacgatgccattctggtttatctgtgggcggggatgctggcaatggacagccca
caaaaagctgaattgattgcgcgttttcagccaatggcggtaatcactcagcagcaaggc
ctgccaccgtttacgaccaacagcgacaatggtaaaactaacggggatgggtcagtgggg
ttttctgcggcattattgccctttttagccagcagcccagagccatttaatcagcaaaca
ctgaatctccaacagcgacgggtacaaaattcaccgcctggcgctgatgattattacagt
gctattctgaccctgtttggtcaggggtggttacagcatcgttatcattttacccatcag
ggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system