KEGG   Yersinia pseudotuberculosis YPIII: YPK_1044Help
Entry
YPK_1044          CDS       T00665                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPK_1044
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YPK_1044
DNA repair and recombination proteins [BR:ypy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     YPK_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 UvrD-helicase DUF2075 PhoH AAA_16 AAA_22 UvrD_C AAA_28 CbiA T2SSE MukB FtsK_SpoIIIE AAA_33 Flavi_DEAD ArgK SRP54 AAA TrwB_AAD_bind NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACA67345
JGI: YPK1044
UniProt: A0A0H3B0K1
Position
1178934..1180907
Genome map
AA seq 657 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIQLAAPTGKAAARLTESLGKAIR
QFFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLASNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNA
GEYRQALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFG
RYQLLCALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLF
NGDIGIALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVL
PNTFMPVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcggttacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattcaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctttcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactagccagcaatgtactaaccaataaggcattagccaataaagcg
cagccagatgaaacctattctgattcagcgaatgtacgcgatagcctgtgtttactgcgt
aaaagttaccgcttcgatgaaaagtcagggattgggcagcttgctctggccgttaatgca
ggggagtatcggcaggctttatccgtattaaacagtgcgtattctgatgttgaacgcttc
ccgctggccgatgaggaagattatcaggtactgctagaggcttgtgctgtggggtatcag
cattacctcgaacgggtggctgcgttagcccctgcggcagaggtattggcagcatttggc
cgctaccaactgctgtgtgcattacgttccgggccattcggtgtcagtggcttaaacgaa
cgcattgaacaggttttacatcgtaaaggattcattatccgtccatcagggccttctggc
cgttggtatgttgggcggccagtgatgatagaacttaatgatagcgcacttggcttattc
aacggggatattggtattgccttacatgataatgaaggcgagctgcgggtatattttcaa
ttgcccgatggcaatataaagtcagtacaacctagtcgccttcccagccatgaaaccgct
tatgctatgacggttcataaatcgcagggttcagagtttgaacacacagcattggtatta
cctaacacgttcatgcccgtgttaactcgtgaattggtctataccgccattacccgcgcc
cgtcagcatctgacgctttattgcagcgatgccgtgctaagtcatgccatacgtacaccg
actctccggcttagcgggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system