KEGG   Yersinia pseudotuberculosis YPIII: YPK_1700Help
Entry
YPK_1700          CDS       T00665                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPK_1700
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    YPK_1700
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPK_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1885132..1886163
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVA
VDQEGGRVQRFRDGFTRLPAAQSFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFAPV
LDIGHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETP
HDNRPLAEIRTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQELG
FEGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKADQL
TRLYHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcccgtgatgttagatgttgccagctatgagctggatgctgaagagcgtgagatt
ttaaaacacccactggtgggagggttgatcttattcagccgtaattttcatgatgcggag
cagttacgcgaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtggtcgca
gtggatcaggaaggggggcgggtccaacgctttcgtgacggttttacccgcctgccagcg
gctcagtctttcgcggctatcaatgatgccgctactgcggctcaactggcgcaagaggcg
gggtggttgatggcagcagaaatgatggcgatggatatcgatatcagttttgctccagta
ctggatattggccatgtcagcgccgcaattggtgagcgttcattccacagtgatccacaa
caggcgcggataatggcggagtgtttcatccgtgggatgcacagtgcagggatgaaaacc
acgggcaagcattttccagggcacggcgcagtaaccgcagattcacataaagagacgcca
catgataatcggccactggcagaaatccgtactcatgatatggttatatttcgtgaattg
atccagcggaaattactggatgcgattatgcctgctcacgtgatttataccgaagccgat
gcacggcctgccagcggttctgcctattggttacaagagatattgcgccaagagctaggg
ttcgagggcatcattttctctgatgatctctcgatggaaggggctgcgatcatgggcagt
tacgccgagcgcggccaggcatcgttggatgccggttgcgatatgattttggtgtgtaat
aaccgtcagggggccgtgagtgtgctggataatctgtctccgatcaaagccgaccaactg
acccgtttgtaccattcagggcaatttgaccgccagacattgatggcttcatcccgttgg
caacaggcgaataaagcattaacggcactcagcgaacgttgggatgcacataaacaaacg
ttggggcaatag

DBGET integrated database retrieval system