KEGG   Yersinia pseudotuberculosis YPIII: YPK_1739Help
Entry
YPK_1739          CDS       T00665                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00052  Galactose metabolism
ypy00511  Other glycan degradation
ypy00600  Sphingolipid metabolism
ypy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YPK_1739
  Lipid metabolism
   00600 Sphingolipid metabolism
    YPK_1739
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YPK_1739
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YPK_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Bgal_small_N DUF4981 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ACA68032
JGI: YPK1739
UniProt: B1JI86
Position
complement(1924556..1927756)
Genome map
AA seq 1066 aa AA seqDB search
MTSQEKVPFQVQLSLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQ
TLNGLWSFSYFTQPEAVPEHWVRCDLAEAKPLPVPANWQLHGYDAPIYTNIQYPIPVNPP
RVPDLNPTGCYSRDFTLEPSWLASGKTRIIFDGVSSAFYLWCNGQWVGYSQDSRLPAEFD
LTPYLQAGSNRIAVLVLRWSDGSYLEDQDMWRMSGIFRDVKLLHKPEIHLRDIHIMTHLS
PEFTSANLEVMAAVNIPSLQLNDPQVTGSYQLRVQLWLADKLVASLQQPLGTQAIDERGP
YTDRTQLVLRIDQPLLWSAEQPTLYRAVVSLLNHQQELIEAEAYDVGFRQVAIHQGLLKI
NGKAVLIRGVNRHEHHPQTGQAIDEESLLQDILLMKQHNFNAVRCSHYPNHPLWYRLCDR
YGLYVVDEANIETHGMQPMSRLSDDPSWFSAFSERVTRMVQRDRNHPCIIIWSLGNESGH
GATHDALYRWIKTNDPTRPVQYEGGGANTLATDILCPMYARVDEDQPFPAVPKWSIKKWI
GLPNESRPLILCEYAHAMGNSFGGFARYWQAFRQYPRLQGGFIWDWVDQSLTHHNDHGQP
YWAYGGDFGDTPNDRQFCMNGLVFPDRSPHPSLYEAQCAQQFFQFSLLSTTPLVINITSE
YLFRESDNEQLYWRIMLEGESVLEGSQPLNLSPESSQCYRLAEKLPTLNKPGQLWLNVEI
RQPKETPWSPAQHRSAWHQWRLPQPLFSPSSDLTNATAHYAPQLQHNLQLQHNRQLQHDL
QLQQDEQHIKVTYQQQCWQFSRQTGRLDQWWVADKPMLLRPLQDQFVRAPLDNDIGISEA
THIDPNAWVERWKKAGMYQLQQRCLSLHVDHLSHSVQISAEYGYEFEQEPLLHSHWVYRF
DRHGRMTIDVNVRIATSLPAPARIGMCCQLADISPTVEWLGLGPHENYPDRQLAAQYGHW
SLPLEQMHTAYIFPSENGLRCNTHTLNYGRWTLTGDFHFGISRYSTQQLMVTSHQHLLEP
EEGTWLNIDGFHMGVGGDDSWSPSVHIDDILTRETYQYQICWQYKV
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacaggaaaaggtaccattccaggtgcaactgagtcttccccagattttgtcc
cgccgagattgggaaaacccgcagatcacacagtatcatcgcctggaggcccacccgcct
tttcacagttggcgtgatgtagaatctgcccagaaggatcgtccttcaccacagcaacaa
acactcaatgggctatggtcattcagctatttcacacaacctgaagcggtacccgagcac
tgggtgaggtgcgatttagccgaggcaaagccgctccctgtaccggctaactggcaactt
catggttatgacgcaccaatttacaccaatatacaataccctattcccgtcaacccacca
cgggtcccggatctaaatccaacgggttgctattcccgtgatttcacgttagagccaagc
tggttggcatcgggtaagactcgcattatttttgacggtgtcagttctgcattttatctg
tggtgtaatgggcaatgggtaggttattcacaagacagccgcctacctgctgagttcgat
ctcaccccctatttgcaggctggcagtaaccgtatcgcagttttagttctgcgctggagt
gatgggagttatcttgaagatcaagatatgtggcgtatgagcggaatttttcgtgatgtg
aaattgttgcataaacccgagattcacttacgggatatccacatcatgacgcatctatcc
cctgaattcacctctgcaaatttagaggtaatggcggccgtcaatatcccctctctacag
ctcaatgatccgcaggtgaccggatcctatcagctccgtgtacaactttggttagccgat
aaattggtcgccagtttacaacagcctttaggcacccaagccattgatgaacgaggtcct
tatactgatcgtacccagctagtattgcgaatagatcagcctctgctctggagtgccgag
cagccgacgctataccgagccgtggtttccttgctcaatcatcagcaagaattgattgag
gccgaagcctatgacgtgggtttcaggcaagtggcaatccatcaaggcttgcttaaaatc
aatggcaaagcggtgctgatcagaggggtgaatcgacatgaacatcacccgcaaacaggt
caggccattgatgaagagagtctgttgcaagacattttattaatgaaacagcataatttt
aatgctgtgcgctgctcccactatcccaatcatcctttatggtaccgcctttgtgaccgc
tatggtttgtatgtggttgatgaagcgaatattgagacacacggtatgcagcccatgagc
aggctgtccgatgacccaagctggttttcagctttcagtgaacgggtgacgcggatggtt
cagcgagatcgcaaccatccatgcattattatctggtcactgggcaatgaatcaggccat
ggcgcaacccatgatgccctctatcgttggataaaaaccaatgaccccacccgccctgtg
caatatgaagggggcggtgccaacaccttagcgaccgacattctgtgtccgatgtatgcc
cgtgttgatgaagaccagccctttcctgccgtccccaagtggtcaatcaaaaaatggatt
ggcttaccgaatgaatctcgccccttgatcctatgtgaatacgcccatgcgatgggcaat
agcttcggtggatttgcccgctattggcaggcatttcgtcagtacccgcgcttacagggc
gggtttatttgggactgggtagaccaaagtctgactcatcataatgaccatggtcagcct
tattgggcgtatgggggtgattttggtgatactcccaatgaccgccagttctgcatgaac
ggattagtcttccctgaccgcagcccgcacccgagcctttatgaagcgcagtgcgcacag
caattcttccaattttcgttgctgagtacgaccccgttggtgatcaacattaccagtgaa
tatttgttccgagagagtgataacgaacaattatattggcggataatgttagagggagaa
tccgtgttggagggtagccaacccctgaatttgtcgcctgaaagctcacagtgctacagg
ttggcagagaaattacccacgcttaataaacctgggcagctatggctgaatgttgagata
aggcaaccaaaagaaaccccgtggtcccctgctcaacatcgcagtgcctggcatcaatgg
cgcttaccacaaccactcttttcgccgtccagtgatctgaccaatgctacagcgcattat
gcccctcaactgcaacataaccttcaactacaacataaccgtcaactacaacatgacctt
caactgcagcaagatgaacagcatattaaggtgacttatcagcaacaatgctggcaattc
agtcgtcaaacggggcggttggatcaatggtgggtggcggataaaccgatgctactgcgc
ccactacaagatcaatttgtgcgtgcgccgctggataacgatatcggtatcagcgaagct
acgcatattgaccccaatgcttgggttgagcgctggaagaaagccggaatgtatcaactc
cagcaacgctgcctctctctacacgtagatcatttatcccattcagtacaaatcagtgcc
gaatacggttatgaattcgagcaagagcccttgctacacagccattgggtataccgtttt
gaccgacatggccgtatgaccattgatgttaacgtccgtatcgctacctcactccctgcg
ccagccagaattggcatgtgttgccaactggctgatatctcacctacggttgaatggcta
gggttggggccacatgaaaactaccctgatcggcagcttgcagcacaatatgggcactgg
tccctgccattagagcagatgcacaccgcgtatattttccccagtgagaatggcttgcgc
tgcaatacccatacgctgaattatggccgctggacgttaacgggcgatttccactttggt
ataagtcgctacagcacccagcaactgatggtgacctcccatcaacatctattggaaccc
gaagagggcacctggctcaatattgatggtttccatatgggggtgggcggtgatgattca
tggagcccgagtgttcacattgatgacatactcacccgtgaaacctatcagtaccaaatc
tgttggcaatacaaggtgtaa

DBGET integrated database retrieval system