KEGG   Yersinia pseudotuberculosis YPIII: YPK_1831Help
Entry
YPK_1831          CDS       T00665                                 

Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ypy00520]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ypy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2029825..2030979
Genome map
AA seq 384 aa AA seqDB search
MQSFLPFSRPAIGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAG
MHITLLALGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAITP
NTKAIIPVHYAGAPCDLDALRQISQRHGIPLIEDAAHAVGTRYRDQWIGEQGTAIFSFHA
IKNITCAEGGLVATDDDELAARVRRLKFHGLGVDAFDRQIQGRSPQAEVVEPGYKYNLSD
IHAAIAVVQLRRLPEINARRQALVASYHKALAHLPLQPLALPHYSHQHAWHLFMVRVDEE
RCGISRDQLMACLKDMGIGSGLHFRAVHSQKYYRERYPHLCLPNTEWNSARLCTLPLFPD
MLDSDIERVANALTTIIGSHRVTK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcagagttttttgcctttttctaggccagcaataggtagtgaagaaattaatgctgtt
gctaatgtattaggctctggttggattactaccggtccccagaatcatcaattggaaact
gatttctgtcaaatttttggttgcaaacatgcgatcgctgtatgttctgcaacagcagga
atgcacattacattgctggcgttgggcattggccctggtgatgaggttattacgccatca
cagacgtgggtttctacgattaacatgatcgtgttgctgggtgcagaacccgtaatggtc
gatgttgatcgcgataccttgatggtaaatgcggctgctattgaagcggcgattacaccg
aacaccaaagccattattcccgtccactatgctggcgcgccctgcgaccttgatgcattg
cgtcagatctcccaacggcatggtatcccactgattgaagatgctgcacatgccgttggc
actcgttatcgagatcaatggattggtgagcaggggaccgctattttctctttccatgcc
atcaagaatatcacttgtgctgagggggggttagttgccaccgatgatgatgaattggcg
gccagagtccgtcggcttaagttccatggcctgggtgtggatgcctttgaccgacaaata
caggggcgtagcccacaggctgaagttgtggaaccggggtataaatataacttatctgat
atccacgccgctattgcggtggtgcagcttagacgtttgcccgaaattaacgcccgtcgg
caggcgctggttgcttcctatcataaggcattagcgcatttgcctttgcagccgttggcc
ttgcctcactattctcatcaacatgcctggcaccttttcatggtgcgtgttgatgaagaa
cgctgtggtattagccgggatcaactgatggcgtgtttgaaagatatgggtattggcagt
gggctacattttcgtgcggtacatagccaaaaatattatcgcgaacgttatccgcatttg
tgtttgcccaacacggaatggaactcagccagattgtgcacgttaccgcttttccccgat
atgctagacagtgatattgaacgagtggctaatgcattaacaacaattatagggtcacac
cgtgtcactaaatga

DBGET integrated database retrieval system