KEGG   Yersinia pseudotuberculosis YPIII: YPK_2073Help
Entry
YPK_2073          CDS       T00665                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2304407..2304997)
Genome map
AA seq 196 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttacttttattactctgcaatgaacgcggggaaatccacagcacttcta
cagtcctcatataactaccaagaacgaggtatgcgcaccttggtgtttacggctgagata
gataaccgctttggtgtcggaacggtaagttcacgcattggcctctcttctcaggcccag
ctctataatagcgggacatcattgttatctattatcgccgctgagcaccaggacacacct
attcattgtattctattggatgaatgtcaatttctgactaaagagcaggtccaggaactc
tgtcaggttgttgatgaattacatcttcctgttctttgctacggcctgcggactgatttt
ctcggcgaattatttcccggtagtaaatatttactggcgtgggcggacaaattagtggag
ttgaaaaccatttgtcattgcggtcgtaaagcaaacatggttcttcgcctggatgagcag
gggagagcggtacacaatggtgaacaggtcgttattggtggcaatgaaagctatgtttct
gtctgccgccgccattataaagaagcaattaaagccgcctgctgttcgtag

DBGET integrated database retrieval system