KEGG   Yersinia pseudotuberculosis YPIII: YPK_2097Help
Entry
YPK_2097          CDS       T00665                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPK_2097
Enzymes [BR:ypy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YPK_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2326327..2327202
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPTAQPAHGFARILPWTLSAHDENENGVILTFTLED
NDMTRQYWPHAFTLIARFKLGDECEVELESHGDYQAAAALHTYFQIGDISQIKVSGLGEK
YLDKVLKVADVTQQGDLVFNGQTDRVYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVAAPDAPARLAMTIRSRKNT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttactctccctgttgttgaacaaatttctccttatatcagccag
cgtcaactggatgaattgccggtagtggttgtttctcatcctaaggtgcgtgcggcaata
agtttgcagggggcccacttactggcctatcaacccagtggtgagcaacccattatctgg
ctgagcaataacacgccttttaaagaaggtattgcgattcgtggaggggttccaatttgt
tggccttggtttggcccaaccgcacaacctgcccatggttttgcccgcatcttgccatgg
acgctcagtgctcatgatgaaaatgaaaacggcgtcattctgactttcacccttgaagac
aacgacatgacccgccaatactggccacatgccttcaccctgatcgcccgtttcaagttg
ggagatgaatgtgaagttgaactggaatcacacggtgattatcaggctgctgcggcatta
catacctacttccagattggcgatataagccaaattaaagtcagcgggctgggtgagaaa
tatttagataaagtgctgaaagttgccgatgtcactcaacaaggcgatttagtctttaac
ggccaaactgaccgtgtctatacccaacctgaagcctatagtctgataaaagatgccgcg
ctgaaacgaactattgaggtccatcaccatcaccaaagtgatgtggttgcctggaacccc
ggcgctgaattgtcctgcagcatggtagatatgccaaatgatggctataaaacgatggtt
tgcgtagaaaccgcacgagtcaacaagccattggtggctgcgcctgatgcaccagcacgt
ttggcgatgaccatccgtagtcgtaaaaacacctaa

DBGET integrated database retrieval system