KEGG   Yersinia pseudotuberculosis YPIII: YPK_2383Help
Entry
YPK_2383          CDS       T00665                                 

Gene name
fliS
Definition
flagellar protein FliS
Orthology
K02422  
flagellar protein FliS
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:ypy02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2617511..2617909
Genome map
AA seq 132 aa AA seqDB search
MYKRSGSQAYAQVGLESGVMSASPHQLIVMLFDGAQSALIRARILMSQGNIPAKGAAISK
AIDIINNGLSAGLNLEKGGEIAENLSALYDYMSRRLLYANLHNDEQAINEVSALLENIAD
AWRQIGPNYQPN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtataagcgatctggaagtcaggcttacgcacaggtaggcctggaaagtggcgtaatg
agtgccagcccacaccaattgatcgtgatgctgttcgatggggcgcaaagcgccctgatt
cgcgcacgtattttgatgagccagggtaatattcccgctaaaggtgccgcaatatccaaa
gcaattgatattattaataacggcctgagtgcggggcttaatttggagaaaggcggcgaa
atagctgaaaatttatcagccttatatgactatatgtcgcggcgcttactgtacgctaat
ttgcataatgacgaacaggcaattaatgaagtgtctgccttgctcgaaaatattgcagat
gcgtggcggcagatcggcccgaattatcaacccaattag

DBGET integrated database retrieval system