KEGG   Yersinia pseudotuberculosis YPIII: YPK_2526Help
Entry
YPK_2526          CDS       T00665                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ypy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2767665..2768996
Genome map
AA seq 443 aa AA seqDB search
MQPTNFNTLINWQQCSEEQQKALLSRPAINASERITAAVSDILDRVKAEGDSALRDFSQR
FDHVQVADIRITASEIAAASARLSDDVKHAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLPSTVLMLGTPARIAGCQRVVLCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVHKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIAADLLSQAEHGPDSQVILLTPDAAIAQAVAVEVEQQLALLSRADI
ARQALESSRLIVTNDLQQCIDISNAYGPEHLILQIRQPEEIIDQIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVTALNNALTAVNKE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctgatcaattggcaacaatgcagtgaagaacagcaa
aaagcgctgttgagccgcccggccatcaatgcatccgagaggatcactgcggcggtcagt
gacatcctggaccgggtgaaagcggaaggcgatagcgccctgcgtgattttagccagcgt
tttgaccatgtgcaggtcgcggatatccgtatcactgcatcagagatcgctgcggcctcg
gcgcgcctgagtgacgatgtcaagcacgccatggcacaggcggtacgtaatattgaaatc
ttccacaacgcgcagaaaatgccggtggtggatgttgaaactcagccgggtgtgcgttgt
cagcaaatcacgcgtccgattgcttccgtcggcttgtatattcccggtggttctgcaccg
ttgccatcaaccgtactgatgctcggcaccccagcacgtattgccggttgtcagcgggtc
gttttatgttctccaccgcctattgccgatgaaattttgtatgccgctcaactgtgcggt
attcaggaagtattccagatcggcggggcacaagcgatcgccgccatggcattcggcagt
gaatcagtacctaaagtgcacaaaatttttgggccgggcaacgcttatgtcactgaagca
aaacgtcaggttagccagcgcctggacggtgctgccatcgatatgcccgcaggcccatca
gaggtgttggtgatcgccgacagcggtgctacacctgcgtttatcgcggcggatttactc
tcacaagcggaacacgggcctgattctcaagtgatcttactgacacctgatgccgctatc
gcacaagcggtggcagtcgaagttgagcaacaactcgcgctgttatcccgagccgatatt
gcccgtcaggcactggaaagcagccgtttgatcgtgaccaacgatttacagcaatgcatt
gatatcagtaatgcatacggccctgagcatttgattctacaaattcgtcaaccagaagaa
atcattgaccagattgataacgctggctccgtgtttatgggcgattggtcaccggaatcg
gctggggattacgcctcgggcaccaaccacgtactgccaacctacggttatacctcaacc
tattccagtttaggtttggctgactttgttaagcgtatgaccgtacagcaattgacacca
cagggtttgttagggctggcctccaccatcgaaacactggcacaggccgaacaactgacc
gcacacaaaaatgcagttaccctgcgcgttaccgccttgaataacgccctgaccgccgtg
aataaggagtaa

DBGET integrated database retrieval system