KEGG   Yersinia pseudotuberculosis YPIII: YPK_2568Help
Entry
YPK_2568          CDS       T00665                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2820526..2821188)
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVMHLLNLDLTDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgagttggttcatcaagcgctgctggcccgtggtctt
gaaacccctttacgtaaaccagaattagatgccgagacgcgcaaaactcggattcaggcc
catatgacagaagtcatgcatttgctgaatcttgatttaaccgacgatagtctggctgat
acaccaagacgcattgcgaagatgtatgttgatgagattttctccggattggattacgaa
aatttccctaaaatcacactgattcaaaataaaatgaaagttgatgaaatggtaacggta
cgggatatcactctgaccagcacctgcgaacatcattttgtgacgattgatgggaaagcc
accgtcgcttatattccgaaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtg
cagttttttgcacagcgtccgcaagtgcaggaacgattaacacagcagatcttgctcgca
ttacaaaccctgttgggtaccaataatgtcgcagtttctattgatgcagttcattattgc
gttaaagcacgtggtatccgtgatgcgaccagcgcgacgaccaccacatcattaggcggg
ttatttaaatccagtcagaatacgcgtcaggaatttctgcgtgcggttcgtcaccacggc
tga

DBGET integrated database retrieval system