KEGG   Yersinia pseudotuberculosis YPIII: YPK_2971Help
Entry
YPK_2971          CDS       T00665                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00020  Citrate cycle (TCA cycle)
ypy00190  Oxidative phosphorylation
ypy00650  Butanoate metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
ypy01120  Microbial metabolism in diverse environments
ypy01130  Biosynthesis of antibiotics
ypy01200  Carbon metabolism
Module
ypy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPK_2971
   00650 Butanoate metabolism
    YPK_2971
  Energy metabolism
   00190 Oxidative phosphorylation
    YPK_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACA69245
JGI: YPK2971
UniProt: A0A0H3B6R4
Position
complement(3271703..3272050)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system