KEGG   Yersinia pseudotuberculosis YPIII: YPK_3159Help
Entry
YPK_3159          CDS       T00665                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPK_3159
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPK_3159
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPK_3159
Lipid biosynthesis proteins [BR:ypy01004]
 Fatty acid synthase
  Component type
   YPK_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3454913..3455485
Genome map
AA seq 190 aa AA seqDB search
MRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQATPSLPKVVNASISGDTAAQGLA
RLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEIINQITAAKAQPLLMQIRIPPN
YGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWMQDDGLHPNGDAQPFIADWMAQ
QLKPLVVDPK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggttac
cgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacgcct
tcgttaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggctagcg
cgcttacccgccctactcaagcaacatcagccacgctgggtgctgattgaactgggtgcc
aatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaattatc
aatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccccaac
tatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacagttc
gacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatgcag
gatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcgcaa
caactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system