KEGG   Yersinia pseudotuberculosis YPIII: YPK_3427Help
Entry
YPK_3427          CDS       T00665                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Brite
Enzymes [BR:ypy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     YPK_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 CMAS GCD14 DREV
Motif
Other DBs
NCBI-ProteinID: ACA69694
JGI: YPK3427
UniProt: B1JJF4
Position
complement(3761397..3762023)
Genome map
AA seq 208 aa AA seqDB search
MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAYENTALPIGAGQTISQ
PYMVARMTELLQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWLGWQSRGPFDAIIVTAAPPEIPDALLEQLDEGGILVLPVGEQFQTLK
YVQRRNNEYHIETVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataaacgcatgcaaacattgttgatgcagttacgtcagcaaggtattcacgac
gaacgcctgttacaggcgatcgaagcggtaccgcgtgagcgttttgtcgatgaagcgttg
gctcataaggcttatgagaataccgctctccctataggtgcgggtcaaacgatttctcag
ccttatatggtggcgcgaatgacagagttactgcaattgacgccaacgtccagagtctta
gagatcggaacggggtcaggctaccagacggctattttggcgcatctggtcgatcatgtc
tgttcagtcgagcgaatcaaagggttacagtggcaggcaaaacgtcgcctaaaacagttg
gatctgcataatgtgtcgacccgccatggtgatggttggttaggctggcagtctcgtggg
ccgtttgatgccattattgtaaccgcagcaccgcctgaaattccggatgcattacttgag
caattggatgaagggggaatactggttcttcccgttggtgagcagttccaaacattaaag
tacgtgcaacgtcgtaacaatgaataccatattgagacggtggaagctgtccgttttgtt
cctctggttaaaggggaacttgcctaa

DBGET integrated database retrieval system