KEGG   Yersinia pseudotuberculosis YPIII: YPK_3471Help
Entry
YPK_3471          CDS       T00665                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3813579..3814058
Genome map
AA seq 159 aa AA seqDB search
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVA
LDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLK
AREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtctatatcgcgctgggtagcaatttggccatgccactacaacaggttagc
gcggcacgggaagccttggcgcatctgccgcgtagccggttagtcgcgtgttcgccactt
taccgcaccaagccattaggcccacaggatcaacccgattttctcaatgccgtggtcgca
ctggatacgtcgttgccaccagagcagttgctggatcacacacaagcgatcgaacgcaac
caaggccgggtgagaaaagagcagcgctgggggccacggacgctggatctggatattatg
ttgtatggcgatcaggtgataaaaactgatcgcctaacgattccgcattatggtctgaaa
gcgcgtgaatttatgctctatccactggcagatatcgccccagatcttattttccccgat
ggcgaatccctatcagaatgccttaagcgggtcgataagaacggcttggttctctggtaa

DBGET integrated database retrieval system