KEGG   Yersinia pseudotuberculosis YPIII: YPK_3523Help
Entry
YPK_3523          CDS       T00665                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ypy00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ypy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3870239..3871726)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLFAPWGLDVPERALREMTLDSRIAAAGDLFVAVVGHQTDGRRYIPQAIAQGV
AAIVAEADGVAPDVSVAEIHGVPVIYLRNLNQHLSTLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWSQALGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFT
AMEVSSHGLIQDRVAALPFAAVVFTNLSRDHLDYHGNMTSYEAAKWLLFSTHQSEHKIIN
ADDDVGRRWLSQLPQAVAVSMAGNVPKGWNGPWLSANKVIYHDNGASIAFDSSWGEGELE
SRLMGAFNVSNLLVALATLLVQGYPMAQLLAAAPHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALAAARLHCTGKLWCVFGCGGDRDKGKRPLMGGIAEQLADCVVVTDDNPRSEE
PQAIVADILSGLLDAGRVQAIHGRAEAVTSAIMQAKEDDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGGQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttattcgctccttgggggctagacgtcccggagcgg
gcgctacgggaaatgacattagacagccgtattgcagctgccggcgatttatttgttgcg
gttgttggccaccagacggatgggcgtcgctatatcccgcaagctatcgcccagggtgtg
gctgcaattgtggccgaagccgatggtgtcgcaccggatgtcagcgttgccgagatacat
ggcgtccctgttatttatttgcgtaatttgaatcagcacttatccacgctggctgggcag
ttttaccatcagcctggcgccgcattgcgtttggtcggtgtaaccggaacgaatggcaaa
accaccactacgcaattgttagcacaatggagccaggcgctgggcgaaaccagtgcagtc
atgggcaccgtaggtaatggtttattagggcaggtgatacccacggagaacaccaccggt
tctgccgtagatattcaacatttgctgcgtaatctggttgatcaaggtgcgacttttacc
gccatggaagtttcttcccacggtttgattcaagaccgtgttgctgcgttaccctttgca
gccgtagtgttcactaacttaagccgcgatcatctggattatcacggcaatatgacgagc
tatgaggcggccaaatggctgctgttctccactcatcagtccgaacacaaaattattaat
gctgatgatgacgttggccgccgttggttaagccaattgccgcaggctgtcgccgtcagc
atggcaggcaatgtccccaaaggctggaatggcccgtggttatctgccaacaaggtgatt
tatcacgataatggtgccagcatcgcgtttgattcaagctggggcgaaggcgagctagaa
agccgtctgatgggcgctttcaacgtcagtaacttgttggtggcattagcgacgttactg
gttcaggggtatcccatggcgcagttgttagctgcagcgcctcatctgcaaccggtttgt
gggcgtatggaagtgtttaatgcgccgggtaaaccaaccgttgtggtggattatgcccac
acgccagatgcattagaaaaagccttggccgccgcccgtttacattgcaccggcaagctg
tggtgtgtgtttggctgtggcggtgaccgtgataaaggtaagcgcccacttatgggcggt
atcgcagaacaactggctgactgtgtcgtggtgaccgatgataacccacgcagtgaagag
ccacaggcgattgttgctgacattctcagtggcttgctggacgcggggcgtgtgcaggcg
atacatggccgtgccgaagccgtaaccagtgccattatgcaagccaaagaagacgacgtt
gtcctgattgccggtaaaggccatgaagattatcaattagttggcaatcgtcgcttggat
tattcagaccgtgtcaccgtcgcgcgtttgttaggggggcaggcatga

DBGET integrated database retrieval system