KEGG   Yersinia pseudotuberculosis YPIII: YPK_3578Help
Entry
YPK_3578          CDS       T00665                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypy00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ypy00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3941750..3942232)
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct
atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg
gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat
attgtcatcagtagccagcctggcactgatgaacgtgtgacgtgggcggcctcgattgaa
gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggtcgcgtc
tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc
ggtggcgatactcacttccctgattatgagccagatgaatgggaaagtgtattcagtgag
tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc
taa

DBGET integrated database retrieval system