KEGG   Yersinia pseudotuberculosis YPIII: YPK_3578Help
Entry
YPK_3578          CDS       T00665                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00670  One carbon pool by folate
ypy00790  Folate biosynthesis
ypy01100  Metabolic pathways
Module
ypy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPK_3578
   00670 One carbon pool by folate
    YPK_3578
Enzymes [BR:ypy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YPK_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ACA69845
JGI: YPK3578
UniProt: A0A0H3B7L8
Position
complement(3941750..3942232)
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct
atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg
gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat
attgtcatcagtagccagcctggcactgatgaacgtgtgacgtgggcggcctcgattgaa
gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggtcgcgtc
tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc
ggtggcgatactcacttccctgattatgagccagatgaatgggaaagtgtattcagtgag
tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc
taa

DBGET integrated database retrieval system