KEGG   Yersinia pseudotuberculosis YPIII: YPK_3626Help
Entry
YPK_3626          CDS       T00665                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPK_3626 (deoA)
Enzymes [BR:ypy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPK_3626 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4001297..4002619)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKL
QAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALG
MAVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEAVRAA
ITLGNNAPEETPVIYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaagaaattatccgtaaaaaacgcgacggtcagccattgagcgaagaa
gagattcgtttttttatcaatgggatccgcgataacgttgtttctgaagggcaaattgcc
gctttagcgatgaccatttatttccacgatatgagtatgcctgagcgcgttgcgctgacc
atggcgatgcgtgattccggtactgtgctgaattggaagagcctgaatctgaatggcccg
ctggtcgataagcactccactggtggcgtgggtgatgtgacgtcactgatgcttggcccg
atggtggcagcttgcggcggctatgtgccgatgatctctggccgtggtcttggtcatacc
ggcggcacactggataaactggaggcgatccccggttttgatattttcccggatgataat
gcgttccgcaaaattattcagaatgttggtgtggcgattatcggccaaaccagctcgctg
gcccctgccgataagcgtttttacgcgacccgcgatattacggcaacagtagattctatt
ccattgattacggcctctatcctggccaaaaaattggcggaagggctggatgcattggtc
atggacgtgaaggtcggctccggtgcctttatgccaacctactcgttgtcggctgatttg
gcgcaggcgattgttggtgtggcaaacggggcgggttgcaaaaccacggcgctcctgacg
gacatgaaccaagtcctggcatccagcgccggtaatggggtcgaagtccgcgaagctgtg
cgtttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgt
gttgaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctg
caagccgttttggataacggcaaagcggcagaagtctttggccgcatggtggccgcgcaa
aaaggcccggtagactttgttgaacgctatgacagctacctgcccgttgctaccctaagc
aaaccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggt
atggcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagt
gtagggctgacggaaatggcccgcttgggtacccgtgttgacgggcagcagccacttgcg
gtgatccatgccaataacgaagatgactggcaacaggcggcagaggctgtgcgtgcggcc
atcaccttagggaataacgcgccagaagaaacgccagtgatttatcgccgtatcactgaa
taa

DBGET integrated database retrieval system