KEGG   Yersinia pseudotuberculosis YPIII: YPK_3639Help
Entry
YPK_3639          CDS       T00665                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPK_3639
   00500 Starch and sucrose metabolism
    YPK_3639
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     YPK_3639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4016327..4017412)
Genome map
AA seq 361 aa AA seqDB search
MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSINAALQSAPPDSSPFVI
FLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGTKWGTSGSSTVLVNAAN
FTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSDKARFRQVKLEGYQDTLY
SKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDISPPYGYITAPSTQNTAPY
GLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPAAIGQAVFINTVMDDHIYGW
DKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQLSAEQLKAFTLPMIFPDWTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaatgctctgagtaagacactattattaggattgatatcatttgccgcttta
ggtgaagtcagcgcggcacagtacaatgctgtggtttctgccatggcgcagggcgatgag
ttctcttcaattaatgcagcgttacaatcagcaccgccagatagttctccgtttgttatt
ttccttaaaaaaggcgtttataccgaacggcttgaggtcaatcgtgacaatgtgacgctg
aaaggtgaggagcgtgatacgacggtgattggcgcgaataccgccgcgggtatgctcaac
ccacaagggacgaagtggggaacctctggcagcagcacggtattggtgaatgccgccaat
tttactgcagaaaatttgacgattcgtaatgacttcgatttccctgctaatcaggcgaaa
gcagagggtgatccgacgaaattaaaagatacgcaggcggtggcgctgttattagcagaa
aaaagtgataaagcccgtttcaggcaagtcaaacttgaggggtaccaagatacgctttat
agcaaaacgggcagtcgtagctactttaccgattgtgacatcagtggccacgtcgatttt
atttttggctcaggggtgacggtatttgaccgctgcaatattattgcccgtgatcgccgt
gatatctccccaccttacggttacattacggcacccagtacccaaaataccgcaccttat
ggtctgattgtcctcaatagtcgtttaaccaaagaaccaggtgtgcctgctaaaagtttt
gccttagggcgcccgtggcaccctactacagcatttgatgatggccgttatgctgatcct
gcggctatcggacaggcggtatttatcaataccgtaatggatgatcatatttatggctgg
gataaaatgtctggaaaagataagcaaggcgagaaagtttggttctatccgcaagactct
cgcttctttgaagcgaacaatcagggaccaggggctgaaattaatgaggggcggcgtcag
ttgtctgctgagcaactaaaagcgttcacattgccaatgatttttcccgactggaccgtt
cagtag

DBGET integrated database retrieval system