KEGG   Yersinia pseudotuberculosis YPIII: YPK_3894Help
Entry
YPK_3894          CDS       T00665                                 

Definition
cystathionine beta-lyase
Orthology
K01760  
cystathionine beta-lyase [EC:4.4.1.8]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypy01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ypy00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:ypy00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4294841..4296022)
Genome map
AA seq 393 aa AA seqDB search
MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVDDIVNNRAVFNYGTAG
TPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHLLMPDSVYKPTRLLCAG
LIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEIQDIPMMTAITKRRGIAT
IIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVSANEQWWPKLRETYDSMAM
LPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEVLRVLHPAFPDCPGHEFWKR
DFTGSSGLFSIVLKPKFTQKGLAEMLDNMSIFAMGFSWGGYESLVIPFDCSEYRTVTKWN
PGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagatatttctagttttggtattagtactcaaataacacaactgggtaga
aatccacaagagcagacgggttttgttaatacaccgatctatcgggggtccacggttatt
tttaatacggtcgatgacattgtcaataatcgtgctgtttttaactatgggacagcaggt
actcccactattgctaatctagagagtgcgtggaccgcactggctggggctgcaggaacc
gtgatttccccttctggcttgggggtgatcgcgttagcattgttaacaacgctaaaagcg
ggtgatcacttgttgatgccagatagtgtgtataaaccgacaaggttactctgtgcgggt
ctgatcgctcggatgggggttgaaacaacatattatgacccattgatcggtgctgaaatt
gaaacattaatgaagccgaatacatcgacgttatttttggagtctcctggctcacaaagc
ttcgaaattcaggatattccgatgatgacggcaatcactaaaaggcgagggattgcgaca
attattgataatacttgggcttcaccgctattttttgccgcccataaacatggctgtgat
ttatcacttgaggcgggtaccaaatatttgggcgggcactctgacctattaatggggctg
gtgtcggcgaacgaacaatggtggcctaaattaagggagacttatgactctatggccatg
ctaccgggggctgaggactgtttcttagcattacgtggcttaaggaccctacatctacga
ataaaagaggcagaaaagcgcggacttgaaatggcgcaatggctgaaagagcggccagaa
gtgttgcgtgttttacatccggcctttcctgattgccctggacatgagttttggaaacgt
gattttaccgggtcatcaggtctattctctattgtattaaagcccaaatttactcaaaaa
gggttggcggagatgttggacaatatgtctatctttgctatgggtttctcttggggggga
tatgagagcctggtgatcccttttgattgctcggaataccgcacggtgacgaaatggaac
ccaggtggattaaccatccgcttacaaatcggtcttgaggatatggaggatctcaaggag
gacttggcgcaaggttttattcgtttagcatcaaatagttaa

DBGET integrated database retrieval system