KEGG   Yersinia pseudotuberculosis YPIII: YPK_3921Help
Entry
YPK_3921          CDS       T00665                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00010  Glycolysis / Gluconeogenesis
ypy00620  Pyruvate metabolism
ypy00640  Propanoate metabolism
ypy00680  Methane metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
ypy01120  Microbial metabolism in diverse environments
ypy01130  Biosynthesis of antibiotics
ypy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPK_3921
   00620 Pyruvate metabolism
    YPK_3921
   00640 Propanoate metabolism
    YPK_3921
  Energy metabolism
   00680 Methane metabolism
    YPK_3921
Enzymes [BR:ypy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YPK_3921
Lipid biosynthesis proteins [BR:ypy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YPK_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA70186
JGI: YPK3921
UniProt: A0A0H3B807
Position
4321256..4323214
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNTSF
DPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVCQF
ANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHS
KLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWHDL
IKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTA
IRALMAEGDKAIGGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacatcctattccagctgcaattgcagagcatgctctaattacc
ccagaaaaataccaacattattaccaacaatcagtgcagaaccctgatgaattctggggc
gaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacctccttt
gaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcggcgaat
tgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaaggtgat
gaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgccagttt
gctaatgtcctaaaaagtttaggcatcaaaaaaggcgatgtagttgccatctatatgcca
atggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcattggcgctgttcattcc
gttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattctcactct
aaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactgaaaaaa
aatgttgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtggtcttc
caacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcatgacctg
ataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccgctgttc
atcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacgggcggt
tatctggtttacgctgcactgacattcaaatatgtttttgattatcaccctggcgatatc
tactggtgtactgcagacgttggctgggtaaccgggcacagttatctattatatggacca
ctggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggcgtcaat
cgcttgagccaggttgttgataaacataaagtcaatattctatacaccgcgcctacagcg
attcgggccttaatggccgaaggtgacaaagccatcggaggaaccaaacgcgactcactg
cgtattatggggtcggtcggcgaaccgattaacccagaagcctgggaatggtattacaac
aagatcggtaacagtaaatgcccgattgtcgatacctggtggcagactgaaaccggtggt
ttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaactcgtcca
ttctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggggtggca
gaaggtaatctggtcataaccgactcatggccggggcaagccagaacattatttggcgat
catgaccgtttcgagcaaacctacttctcaacctttaaaggcatgtatttcagtggcgac
ggcgcacgtcgtgacgaagacggttactactggataaccggtcgagtcgatgacgtacta
aacgtttcaggccatcgcttaggaacggctgaaattgaatctgcactggttgcacacccg
aaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggctatttat
gcctatatcacgctaaatcacggtgaagaaccaactccagagttatataccgaagtacgc
aactgggtacgtaaagagattggcccacttgcaacacccgatattttgcattggacggac
tcattacccaaaacccgttcaggcaaaatcatgcgccgtattttacgcaaaattgcgaca
ggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggtagaaaaa
ttactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system