KEGG   Yersinia pseudotuberculosis YPIII: YPK_4118Help
Entry
YPK_4118          CDS       T00665                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00010  Glycolysis / Gluconeogenesis
ypy00051  Fructose and mannose metabolism
ypy00562  Inositol phosphate metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
ypy01120  Microbial metabolism in diverse environments
ypy01130  Biosynthesis of antibiotics
ypy01200  Carbon metabolism
ypy01230  Biosynthesis of amino acids
Module
ypy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypy_M00002  Glycolysis, core module involving three-carbon compounds
ypy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPK_4118
   00051 Fructose and mannose metabolism
    YPK_4118
   00562 Inositol phosphate metabolism
    YPK_4118
Enzymes [BR:ypy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPK_4118
Exosome [BR:ypy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPK_4118
  Exosomal proteins of bladder cancer cells
   YPK_4118
  Exosomal proteins of melanoma cells
   YPK_4118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA70377
JGI: YPK4118
UniProt: B1JQ90
Position
4551843..4552610
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system