KEGG   Yersinia pseudotuberculosis YPIII: YPK_4126Help
Entry
YPK_4126          CDS       T00665                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00010  Glycolysis / Gluconeogenesis
ypy00030  Pentose phosphate pathway
ypy00051  Fructose and mannose metabolism
ypy00052  Galactose metabolism
ypy00680  Methane metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
ypy01120  Microbial metabolism in diverse environments
ypy01130  Biosynthesis of antibiotics
ypy01200  Carbon metabolism
ypy01230  Biosynthesis of amino acids
ypy03018  RNA degradation
Module
ypy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPK_4126
   00030 Pentose phosphate pathway
    YPK_4126
   00051 Fructose and mannose metabolism
    YPK_4126
   00052 Galactose metabolism
    YPK_4126
  Energy metabolism
   00680 Methane metabolism
    YPK_4126
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YPK_4126
Enzymes [BR:ypy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YPK_4126
Protein phosphatases and associated proteins [BR:ypy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YPK_4126
Messenger RNA biogenesis [BR:ypy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YPK_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACA70385
JGI: YPK4126
UniProt: B1JQU4
Position
complement(4559493..4560476)
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGSYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgacggttcttatgctggtgcggacctgctgacgaaagaagggggtattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgctggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgagaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgcatccttgcttcccgtatggggtcttatgctgtcgatctgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtgcagaatgagaagatggtgcatgaa
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system