KEGG   Yersinia pestis Z176003: YPZ3_0078Help
Entry
YPZ3_0078         CDS       T01210                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00010  Glycolysis / Gluconeogenesis
ypz00051  Fructose and mannose metabolism
ypz00562  Inositol phosphate metabolism
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
ypz01230  Biosynthesis of amino acids
Module
ypz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypz_M00002  Glycolysis, core module involving three-carbon compounds
ypz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPZ3_0078
   00051 Fructose and mannose metabolism
    YPZ3_0078
   00562 Inositol phosphate metabolism
    YPZ3_0078
Enzymes [BR:ypz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPZ3_0078
Exosome [BR:ypz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPZ3_0078
  Exosomal proteins of bladder cancer cells
   YPZ3_0078
  Exosomal proteins of melanoma cells
   YPZ3_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE62988
Position
complement(96169..96885)
Genome map
AA seq 238 aa AA seqDB search
MVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIALGAQNVDVNLSGAFTGE
TSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIGLIPVLCIGESEAENEAG
QTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQ
DAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKADAFAVIVKAAAKAKKA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggc
gttgccattgccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagc
cgtattgctctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaa
acatctgctgaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgag
cgccgtacttatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaa
gagatcggcttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggc
caaactgaagcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaa
gcgttcgaaggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatca
gcaactccagcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaa
gacgcagcagttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaac
gcagcagaattgttcactcagccagatattgatggcgcactggttggcggtgcatcactg
aaagcagacgctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system