KEGG   Yersinia pestis Z176003: YPZ3_0078Help
Entry
YPZ3_0078         CDS       T01210                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypz  Yersinia pestis Z176003
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPZ3_0078
   01230 Biosynthesis of amino acids
    YPZ3_0078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPZ3_0078
   00051 Fructose and mannose metabolism
    YPZ3_0078
   00562 Inositol phosphate metabolism
    YPZ3_0078
Enzymes [BR:ypz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPZ3_0078
Exosome [BR:ypz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPZ3_0078
  Exosomal proteins of bladder cancer cells
   YPZ3_0078
  Exosomal proteins of melanoma cells
   YPZ3_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(96169..96885)
Genome map
AA seq 238 aa AA seqDB search
MVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIALGAQNVDVNLSGAFTGE
TSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIGLIPVLCIGESEAENEAG
QTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQ
DAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKADAFAVIVKAAAKAKKA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggc
gttgccattgccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagc
cgtattgctctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaa
acatctgctgaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgag
cgccgtacttatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaa
gagatcggcttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggc
caaactgaagcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaa
gcgttcgaaggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatca
gcaactccagcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaa
gacgcagcagttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaac
gcagcagaattgttcactcagccagatattgatggcgcactggttggcggtgcatcactg
aaagcagacgctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system