KEGG   Yersinia pestis Z176003: YPZ3_0424Help
Entry
YPZ3_0424         CDS       T01210                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPZ3_0424
Enzymes [BR:ypz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPZ3_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511593..512228
Genome map
AA seq 211 aa AA seqDB search
MHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFINGI
RDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGG
VGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIMLV
WRLSAKPARWPLPISVFTRPAILRQQSILFH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtaggctgaaggcctgctgtgtcgctatttccgaaagcgcctgtgggcggctt
tcatcccatattccggtcaagcagggggatgccttgtttctggcacaagaaattatccgt
aaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatgggatc
cgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttccac
gacatgagcatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtactgtg
ctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggtggc
gtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcctgcggcggctatgtg
ccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggaggcg
atccccggttttgatattttcccggatgataatgcgttccgcaaaattattatgttggtg
tggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcgaccc
gcgatattacggcaacagtcgattctattccattga

DBGET integrated database retrieval system