KEGG   Yersinia pestis Z176003: YPZ3_0425Help
Entry
YPZ3_0425         CDS       T01210                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPZ3_0425
Enzymes [BR:ypz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPZ3_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512225..513004
Genome map
AA seq 259 aa AA seqDB search
MITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLTD
MNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKLQ
AVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALGM
AVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEVVRAAI
TLGNNTPEETPVIYRRITE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgattacggcctctattctggccaaaaaattggcggaagggctggatgcattggtcatg
gacgtgaaggtcggctccggtgcctttatgccaacctactcgttgtcggctgatttggcg
caggcgattgttggtgtggcaaacggtgcgggttgcaaaaccacggcgctactgacggac
atgaaccaagtcctggcgtccagcgccggtaatggggtcgaagtccgcgaagctgtgcgt
ttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgtgtt
gaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctgcaa
gccgttttggataatggcaaagcggcggaagtctttggccgtatggtggccgcgcaaaaa
ggcccggcagactttgttgaacgctatgacagctacctgcccgttgctaccctaagcaaa
ccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggtatg
gcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagtgta
gggctgacggagatggcccgtttgggtacccgtgttgatgggcagcagccgcttgcggtg
atccatgccaataacgaagatgactggcagcaggcggcagaggttgtgcgtgcggccatc
accttagggaataacacgccagaagaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system