KEGG   Yersinia pestis Z176003: YPZ3_0832Help
Entry
YPZ3_0832         CDS       T01210                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (DsbC)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ypz  Yersinia pestis Z176003
Brite
Enzymes [BR:ypz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YPZ3_0832 (dsbC)
Secretion system [BR:ypz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YPZ3_0832 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1076894..1077610
Genome map
AA seq 238 aa AA seqDB search
MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYI
SADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDITCG
YCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCMADRNKAFDDAMKNNDIS
PATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttattgctgctgccaatgttaatggctgcattatcgggggttgctaat
gcagatgattctgctattcagcaaaccttaaaaaaattagatatccaacaagctgatatc
cagccgtcacctatcccaggcattagtacggtgatgaccgaaagcggcgtgctctatatc
tcagcagatggtaaacatctgctgcaagggccgctgtatgacgtgagtggcgatcagccc
atcaatgtgaccaatcaggcgttgctgaaaaaactggaagcattgagcagtgaaatgatt
gtgtataaagcacccgaggaaaaacacgtcattacggtgttcacagacattacctgcggc
tactgccgtaaattgcacgaacaaatgaaagattataatgcgcttggcatcactgttcgc
tatctggccttcccgcgtcaggggttaagctctcaggcggaaaaagacatgcgttctatc
tggtgtatggctgatcgtaataaagcctttgatgatgccatgaaaaataatgatatctcc
ccagcaacctgcaaaaccgatatcagcaagcattatcagctaggtgtgcaatttggtatc
cagggtacgccagctattgtgctgcaaaatggcactattgtcccaggctatcagggaccg
aaagaaatgctacagatgcttaatgcgcatcaggcttcactaaaagcgggtggttga

DBGET integrated database retrieval system