KEGG   Yersinia pestis Z176003: YPZ3_0929Help
Entry
YPZ3_0929         CDS       T01210                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypz  Yersinia pestis Z176003
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPZ3_0929
Enzymes [BR:ypz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YPZ3_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1208818..1210773
Genome map
AA seq 651 aa AA seqDB search
MTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPELL
FGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYEG
DVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVAA
TRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIRQ
FFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARL
IAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNAL
TSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQA
LSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLLC
ALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIGI
ALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMP
VLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcagttt
tcacgaatgattgccggcgatgatgacccgcgattacaactggccgcagcgatccttagt
gcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactgcta
ttcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgccagat
aaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaacca
acaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaagga
gatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgattttatg
accagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagacgct
ttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcggct
acccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagtagcc
aaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaacttgcg
gccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcggcaa
ttctttcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcaccgt
ttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccattaaat
cttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgctta
attgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactggcc
tcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttacagc
gagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgcatta
accagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacctat
tctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttcgat
gaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcaggct
ttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgaggaa
gattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgggtg
gctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctgtgt
gcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtttta
catcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttgggcgg
ccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggtatt
gccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaatata
aagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggttcat
aaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatgccc
gtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacgctt
tattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagtggg
ctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system