KEGG   Yersinia pestis Z176003: YPZ3_1184Help
Entry
YPZ3_1184         CDS       T01210                                 

Definition
putative ABC transport integral membrane subunit
Orthology
K02057  
simple sugar transport system permease protein
Organism
ypz  Yersinia pestis Z176003
Module
Putative simple sugar transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1526552..1527550
Genome map
AA seq 332 aa AA seqDB search
MDKATETRREGAPTASKLNGQAMLGWVLHHIVWIWLIALVVIFGVFNEFFLTISNLQNVM
VQATVLGTLGLAVALPLLVAEIDLSIPANAGFSAAVGAMAYAELGLPWPIAALIGLLVGT
FIGFFNGVCITRLKMVSLIETLAMMIIIQGALLALTQGKTLTNLSEGYIWIGQATIGGWP
LMPVVFLLVLAVMGAVLKYTVLGRSIYAVGGNPVASNSAGIRVARVKIIAYTISGFLAAL
AGFLLASWQMAITSNQGSSYLLYAIAAPIIGGVSVFGGHGNVKGVLGGVLLLTVIQVGLA
IVNVPSFYVGMIGGVIIFIAVAIDAFRIRYFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggataaggcaaccgagacccgccgcgagggagcacctaccgcgagcaaactcaacggc
caggccatgctgggctgggttttacaccatattgtctggatctggctgattgcactggtt
gtcatctttggtgtcttcaatgaatttttcctgacgatatccaatctgcaaaacgtgatg
gtgcaggccacggttttgggaaccttagggctggcggtggcactgccgctgctggtggct
gagattgacttgtcgattccggcaaatgcgggtttctcggcggcggtgggggcgatggct
tatgccgaactggggctgccgtggcctattgcagcattaataggtttactggttggcaca
tttatcggtttcttcaatggggtgtgcatcacccgattgaaaatggtctcgctgatagag
acgttggcgatgatgattattatccagggcgcgctgttggcgctgacacagggcaagacc
ctgacaaacctttctgaaggttatatttggattggccaggcgaccatcggggggtggccc
ctgatgccggtggtgtttcttctggtgctggcggtgatgggggcggtgctgaagtatacg
gtgttaggccgttcgatctatgccgtcggtggtaatcctgttgcgtcaaactccgccggg
attcgggtcgcgcgggtcaaaattattgcttacacgatttcagggttccttgccgcactt
gctggctttttgttggcatcgtggcagatggccatcacctcaaaccaaggctcgagctac
ttgctctacgccatcgccgcgcccattatcggcggcgtcagtgtttttggtgggcacggt
aacgtcaagggggtgctgggcggtgtgctgctgctgacggtgatccaagttggcctcgcc
attgtcaatgtcccttcgttctatgtcggcatgattggcggggtgatcatttttatcgct
gtcgccattgatgctttccggatccgttacttcggatag

  All links  
No link information was found.   
DBGET integrated database retrieval system