KEGG   Yersinia pestis Z176003: YPZ3_1573Help
Entry
YPZ3_1573         CDS       T01210                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ypz  Yersinia pestis Z176003
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypz00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ypz00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ypz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2038833..2040278
Genome map
AA seq 481 aa AA seqDB search
MNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQFGGARRLTED
QTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYA
LDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVST
AELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEGRADVTLGGGA
ASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGLFSPGNMPVRW
QGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDK
QDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQ
ALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAL
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgtacctactttatccggcatagcattatcatccggcatagcattatcgact
ctgttactgtccagtgcgctattaacgcctaatgcgattgcggctgctacgggcttatat
gaccgtgctgcgcatggtgatgtgactcaatttggcggcgcacgtcgtttgactgaagac
caaacccaggctctgcgtgactcgttatccaataaaacagtaaaaaatgtcattttgttg
attggagatgggatgggcgattctgaaatcacgtctgcccgtaactatgcgatgggggcc
ggtggtttctttaaaggcattgatgcgctgccgctgaccgggcaatacacgcactatgca
ctcgataaaaaaacacaaaaaccaaattatgtgactgattctgctgcatcagcgacggcc
tggtcatctggcgtaaaaacgtataatggtgcgttgggggttgatgtttttggtaaagac
catgttacgttgctggaactggccaaaaaagcaggcaaagcgacgggtaatgtctctacc
gctgaactacaagatgccactcctgctgcgcagtttgcccacgtgaccgggcgtaagtgc
tatggcccggaagaaaccagtgagaaatgcagtaccaatgcattggaaaaagggggccgt
ggctctattactgagcaaatgattgaagggcgcgctgatgtcacgcttggcggtggtgca
gcatcattcagccaggtcgctaaagccggtgagtggaaagaccagtcgttgcgtgatcag
gcgttggcccgcggctacgtcattgttgagaaccttgatgacctgaacgcaataaaacac
gctaatcaacagaaacctctattgggcttattctcgccaggtaatatgccagtgcgttgg
caggggccaaaagcctcttatcatggcaatctggataaaccgccagtggtgtgtgaaaac
aatgctgagcggaccagcgacattccaacgttggctgtcatgacagaaaaagccattgac
ctgctgaaaaccaatgagaatggcttcttcttgcaagttgaaggggcgtcgattgataaa
caggatcactccgctaacccatgtggtcagtttggtgaaacggttgatctggatgaagcg
gtacaaaaagcgctggaattcgcccgtgctgatggcaacactttggtgattgtgacggct
gaccatgctcactccagccaaattatcgagcctgaagcgaaggctccgggcctgactcag
gcattaacgaccaaagatggcgcggtcatggcgatcagctacggtaactctgaagacgat
tctcaaggccatactgggtcacaattgcggatagcggcttatggtcctcacgcggctaac
gtcgtaggtttaactgaccaaactgatttgttcttcaccatgcgggatgcgatggcactt
aaataa

DBGET integrated database retrieval system