KEGG   Yersinia pestis Z176003: YPZ3_1646Help
Entry
YPZ3_1646         CDS       T01210                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00260  Glycine, serine and threonine metabolism
ypz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01130  Biosynthesis of antibiotics
ypz01230  Biosynthesis of amino acids
Module
ypz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPZ3_1646 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPZ3_1646 (trpB)
Enzymes [BR:ypz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YPZ3_1646 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE64556
Position
2134084..2135274
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILVPALKQLEDAFVSAQLDPEFQAAFQDLLKNYAGRPTALTL
CQNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGTY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPDVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALDAFKTLSCKEGIIPALESSHALAHALKM
IKADPDKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacttaatccctattttggcgaatttggcggtatgtatgtgccccaaatttta
gtgccagccctgaagcaactggaagacgcattcgtcagtgctcaactggatcctgaattt
caggccgcatttcaagatttgttaaaaaactatgccggtcgccctaccgccctgaccttg
tgtcaaaatctgaccaaagggacaaagaccaagctatatctgaaacgtgaagatctgctg
cacggcggtgcacacaaaaccaaccaggttttaggtcaggctttattagctaaacgcatg
ggtaaaactgaaattattgccgaaaccggtgccggccagcacggggttgcctccgcactg
gcttgtgcattgctgggtttaaaatgccgcatttatatgggggcgaaagatattgaacgt
cagtcgcctaacgttttccgtatgcgcctgatgggagccgaggttattccagtgcatagt
ggttcatcgacgctgaaagatgcctgtaatgaagcgctacgtgactggtcaggtacttat
gaaaccgctcactatatgctgggtaccgccgctggccctcacccttacccgacaattgtg
cgcgaattccaacgcatgatcggtgaagaaaccaaggctcagatactggaaaaagaaggc
cgcctgcccgatgcagtattggcctgtgttggtggcggttctaatgctatcggtatgttt
gctgattttattgatgagcctgatgtgggtctgattggcgtagagcctgccggcttgggg
atcgaaaccgggcaacatggtgcccccctaaaacacggtaaggtcggtatctacttcggt
atgaaatcaccgatgatgcagaccagcgatgggcaaattgaagaatcttactctatttct
gccggtctggacttcccctctgtggggccgcaacatgcttatttgaacagtattgggcgg
gctgattatgtctccattaccgatgatgaggctttagacgcatttaagacattgtcatgt
aaagaagggattattccagcgctagagtcctctcatgctctggcacatgcgttgaaaatg
attaaagcggatccggataaagaacaaatactggtggtgaatctctccggccggggtgac
aaagatattttcaccgttcacgatattctgaaagcacggggagagatttaa

DBGET integrated database retrieval system