KEGG   Yersinia pestis Z176003: YPZ3_1684Help
Entry
YPZ3_1684         CDS       T01210                                 

Gene name
pncA
Definition
putative pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ypz  Yersinia pestis Z176003
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ypz00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183475..2184122
Genome map
AA seq 215 aa AA seqDB search
MKAALLLIDLQNDFCPGGALAVSEGDEVISVANRMIEACLAKNIPVIASQDWHPIEHRSF
AVNAKAEPGTVGELEGLVQVWWPVHCVQEQPGAALHPQLKQGAITAIFRKGQNPDIDSYS
TFFDNGRRAKTALDSWLQQHSIDHLYVMGLATDYCVKYSVLDALALGYQTTVISDGCRGV
NLQPQDSQLAFDAMSDAGANLLALEQCLAEVVSAD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccttgctcttaatcgatttacaaaacgacttttgtcctggtggagcgttg
gctgttagtgaaggtgatgaggtcattagcgtggctaaccgcatgattgaagcctgtctc
gcaaaaaacataccggtgattgccagccaagattggcacccaattgagcaccgtagcttt
gcggtgaacgccaaggcggagccgggcacagttggggaactagaagggttagtacaagta
tggtggccggtacattgtgttcaggaacaaccaggggcagcattgcacccacagctgaaa
caaggcgctattacagctatttttcgcaaagggcaaaaccctgatatcgacagttacagc
actttcttcgacaatggccggcgagctaaaacagcattagatagctggctacaacagcat
agcattgaccacctgtatgttatggggctggccacagattactgtgtgaaatatagcgta
ctggatgcactcgctttgggttatcaaaccacggttatcagtgatgggtgtcgtggggta
aacttgcaaccacaagacagccaactggctttcgatgcaatgagcgatgcaggcgccaac
ttactggctcttgaacaatgcctggctgaagtcgtttcagccgactga

DBGET integrated database retrieval system