KEGG   Yersinia pestis Z176003: YPZ3_2041Help
Entry
YPZ3_2041         CDS       T01210                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ypz  Yersinia pestis Z176003
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ypz00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ypz00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ypz00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2624951..2628103
Genome map
AA seq 1050 aa AA seqDB search
MQLSLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLWSFSY
FTQPEAVPEHWVRCDLAEAKPLPVPANWQLHGYDAPIYTNIQYPIPVNPPRVPDLNPTGC
YSRDFTLEPSWLASGKTRIIFDGVSSAFYLWCNGQWVGYSQDSRLPAEFDLTPYLQAGSN
RIAVLVLRWSDGSYLEDQDMWRMSGIFRDVKLLHKPEIHLRDIHIMTHLSPEFTSANLEV
MAAVNIPSLQLNDPQVTGSYQLRVQLWLADKLVASLQQPLGTQAIDERGPYTDRTQLVLR
IDQPLLWSAEQPTLYRAVVSLLNHQQELIEAEAYDVGFRQVAIHQGLLKINGKAVLIRGV
NRHEHHPQTGQAIDEESLLQDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEAN
IETHGMQPMSRLSDDPSWFSAFSERVTRMVQRDRNHPCIIIWSLGNESGHGATHDALYRW
IKTNDPTRPVQYEGGGANTLATDILCPMYARVDEDQPFPAVPKWSIKKWIGLPNESRPLI
LCEYAHAMGNSFGGFARYWQAFRQYPRLQGGFIWDWVDQSLTHHNDHGQPYWAYGGDFGD
TPNDRQFCMNGLVFPDRSPHPSLYEAQCAQQFFQFSLLSTTPLVINITSEYLFRESDNEQ
LYWRIMLEGESVLEGSQPLNLSPESSQCYRLAEKLPTLNKPGQLWLNVEIRQPKETPWSP
AQHRSAWHQWRLPQPLFSPSSDLTNATAHYAPQLQHNLQLQHDLQLQQDEQHIKVTYQQQ
CWQFSRQTGRLAQWWVADKPMLLRPLQDQFVRAPLDNDIGISEATHIDPNAWVERWKKAG
MYQLQQRCLSLHVDHLSHSVQISAEYGYEFEQEPLLHSHWVYRFDRHGRMTIDVNVRIAT
SLPAPARIGMCCQLADISPTVEWLGLGPHENYPDRQLAAQYGHWSLPLEQMHTAYIFPSE
NGLRCNTHTLNYGRWTLTGDFHFGISRYSTQQLMVTSHQHLLEPEEGTWLNIDGFHMGVG
GDDSWSPSVHIDDILTRETYQYQICWQYKV
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
gtgcaactgagtcttccccagattttgtcccgccgagattgggaaaacccgcagatcaca
cagtatcatcgcctggaggcccacccgccttttcacagttggcgtgatgtagaatctgcc
cagaaggatcgtccttcaccacagcaacaaacactcaatgggctatggtcattcagctat
ttcacacaacctgaagcggtacccgagcactgggtgaggtgcgatttagccgaggcaaag
ccgctccctgtaccggctaactggcaacttcatggttatgacgcaccaatttacaccaat
atacaataccctattcccgtcaacccaccacgggtcccggatctaaatccaacgggttgc
tattcccgtgatttcacgttagagccaagctggttggcatcgggtaagactcgcattatt
tttgacggtgtcagttctgcattttatctgtggtgtaatgggcaatgggtaggttattca
caagacagccgcctacctgctgagttcgatctcaccccctatttgcaggctggcagtaac
cgtatcgcagttttagttctgcgctggagtgatgggagttatcttgaagatcaagatatg
tggcgtatgagcggaatttttcgtgatgtgaaattgttgcataaacccgagattcactta
cgggatatccacatcatgacgcatctatcccctgaattcacctctgcaaatttagaggta
atggcggccgtcaatatcccctctctacagctcaatgatccgcaggtgaccggatcctat
cagctccgtgtacaactttggttagccgataaattggtcgccagtttacaacagccttta
ggcacccaagccattgatgaacgaggtccttatactgatcgtacccagctagtattgcga
atagatcagcctctgctctggagtgccgagcagccgacgctataccgagccgtggtttcc
ttgctcaatcatcagcaagaattgattgaggccgaagcctatgacgtgggtttcaggcaa
gtggcaatccatcaaggcttgcttaaaatcaatggcaaagcggtgctgatcagaggggtg
aatcgacatgaacatcacccgcaaacaggtcaggccattgatgaagagagtctgttgcaa
gacattttattaatgaaacagcataattttaatgctgtgcgctgctcccactatcccaat
catcctttatggtaccgcctttgtgaccgctatggtttgtatgtggttgatgaagcgaat
attgagacacacggtatgcagcccatgagcaggctgtccgatgacccaagctggttttca
gctttcagtgaacgggtgacgcggatggttcagcgagatcgcaaccatccatgcattatt
atctggtcactgggcaatgaatcaggccatggcgcaacccatgatgccctctatcgttgg
ataaaaaccaatgaccccacccgccctgtgcaatatgaagggggcggtgccaacacctta
gcgaccgacattctgtgtccgatgtatgcccgtgttgatgaagaccagccctttcctgcc
gtccccaagtggtcaatcaaaaaatggattggcttaccgaatgaatctcgccccttgatc
ctatgtgaatacgcccatgcgatgggcaatagcttcggtggatttgcccgctattggcag
gcatttcgtcagtacccgcgcttacagggcgggtttatttgggactgggtagaccaaagt
ctgactcatcataatgaccatggtcagccttattgggcgtatgggggtgattttggtgat
actcccaatgaccgccagttctgcatgaacggattagtcttccctgaccgcagcccgcac
ccgagcctttatgaagcgcagtgcgcacagcaattcttccaattttcgttgctgagtacg
accccgttggtgatcaacattaccagtgaatatttgttccgagagagtgataacgaacaa
ttatattggcggataatgttagagggagaatccgtgttggagggtagccaacccctgaat
ttgtcgcctgaaagctcacagtgctacaggttggcagagaaattacccacgcttaataaa
cctgggcagctatggctgaatgttgagataaggcaaccaaaagaaaccccgtggtcccct
gctcaacatcgcagtgcctggcatcaatggcgcttaccacaaccactcttttcgccgtcc
agtgatctgaccaatgctacagcgcattatgcccctcaactgcaacataaccttcaacta
caacatgaccttcaactgcagcaagatgaacagcatattaaggtgacttatcagcaacaa
tgctggcaattcagtcgtcaaacggggcggttggcgcaatggtgggtggcggataaaccg
atgctactgcgcccactacaagatcaatttgtgcgtgcgccgctggataacgatatcggt
atcagcgaagctacgcatattgaccccaatgcttgggttgagcgctggaagaaagccgga
atgtatcaactccagcaacgctgcctctctctacacgtagatcatttatcccattcagta
caaatcagtgccgaatacggttatgaattcgagcaagagcccttgctacacagccattgg
gtataccgttttgaccgacatggccgtatgaccattgatgttaacgtccgtatcgctacc
tcactccctgcgccagccagaattggcatgtgttgccaactggctgatatctcacctacg
gttgaatggctagggttggggccacatgaaaactaccctgatcggcagcttgcagcacaa
tatgggcactggtccctgccattagagcagatgcacaccgcgtatattttccccagtgag
aatggcttgcgctgcaatacccatacgctgaattatggccgctggacgttaacgggcgat
ttccactttggtataagtcgctacagcacccagcaactgatggtgacctcccatcaacat
ctattggaacccgaagagggcacctggctcaatattgatggtttccatatgggggtgggc
ggtgatgattcatggagcccgagtgttcacattgatgacatactcacccgtgaaacctat
cagtaccaaatctgttggcaatacaaggtgtaa

DBGET integrated database retrieval system