KEGG   Yersinia pestis Z176003: YPZ3_2169Help
Entry
YPZ3_2169         CDS       T01210                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPZ3_2169
Enzymes [BR:ypz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPZ3_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2793265..2794164
Genome map
AA seq 299 aa AA seqDB search
MFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYNLLEAGRL
WGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLPPQLLARF
SSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDAILVYLWA
GMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAALLPFLASS
PEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQPSWHRQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgtttattggcttggacagaaaacaatctggcagccggtgatctcacttcc
cgccttcccgcttggttatgggggcaaaactcacaaaataactgggatattctggaccct
aattcggcctccgatgcggatatcttgattgcctacaacttgctggaggctggcaggtta
tggggtaaccgccgttacctgattatgggtaccttattactgcaacgtattgcgcaagaa
gaagtcatggatattcccggccttggccagatgctattaccgggaaaaattggttttaac
gatgaggatacctggcgtctcaacccaagttatttaccgccacaactactggcacgattt
tcctccatagacgggccttgggaagcgatggtagaagtgaatcagcgtatgtggctggaa
accgcaccaaacggtttttcgctggactgggtggtctggcagaaaggtaaaggctggcag
cccgataccataaaaccggatgtcggcagtaacgatgccattctggtttatctgtgggcg
gggatgctggcaatggacagcccacaaaaagctgaattgattgcgcgttttcagccaatg
gcggtaatcactcagcagcaaggcctgccaccgtttacgaccaacagcgacaatggtaaa
actaacggggatggggcagtgggtttttctgcggcattattgccctttttagccagcagc
ccagaaccgtttaatcagcaaacactgaatctccaacagcgacgggtacaaaattcaccg
cctggcgctgatgattattacagtgctattctgaccctgtttggtcaggggtggttacag
catcgttatcattttacccatcagggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system