KEGG   Yersinia pestis Z176003: YPZ3_2216Help
Entry
YPZ3_2216         CDS       T01210                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ypz  Yersinia pestis Z176003
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPZ3_2216
Enzymes [BR:ypz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     YPZ3_2216
Exosome [BR:ypz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPZ3_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2868265..2870112
Genome map
AA seq 615 aa AA seqDB search
MAEGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRREN
GIWELFLPGIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISPLPDVVKSSAA
RQKANDLCSPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEH
PFDGSWGYQPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGHFPSDEHGLSTFD
GTALYEYADPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIY
RDYSRAEGQWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAEESTDFPGVTLPPDI
GGLGFNYKWNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPLSHDEVVHGK
RSILDRMPGDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGREWNFETSLDWHLLDDE
NGWHSGVQRLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHENSVFAFLRRDAEGHELI
AISNFTPVPRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQGGIDSHHVRSHNHEHSLL
LTLPPLATIYLLREN
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaaggtacccatttacgcccttatgaacgtttgggggcgcatttaatgagcctt
gatggtgtatccggtgtcagttttgcggtttgggcaccgaatgctcagcgggtatccgtg
gtgggggattttaacttttgggatggccgccgccatccgatgcgcttacggcgtgaaaat
ggcatttgggagctatttctgccaggaatagaggcggggcagttgtataagtttgagatc
attgattgccatggccaggtgcgtctgaaagctgacccttacgcttttgaagcgcagatg
cggccagaaaccgcctcattgattagcccgctacccgatgtagtgaagagtagcgccgca
cggcaaaaagccaatgatttatgttccccggtgtctatctatgaagtgcatctcggttcg
tggcgtcggcataccgataataatttctggttgagttaccgcgaattggcggatcaactg
gtcgaatacgttaaatatatgggttttacccatgtcgagctgctgccgattaacgaacat
ccatttgacggtagctggggttatcagccgctaggattatatgcaccgacccgccgttac
ggcaccccagaggatttcaaagcgttcgtcgccaaattccatcaggcaggaattaacgtg
atccttgattgggttcccggccattttcccagtgatgagcatggattatcgaccttcgat
ggcactgcgttgtatgaatatgctgatccgcgcgaagggtaccatcaggattggaatacc
ctgatctataactatggccgtaacgaagtccgtaactatctggcgggcaatgcattctac
tggatggaacgttttggcatcgatgcgttgcgtattgatgcggtggcctcaatgatttac
cgcgattatagccgtgctgaagggcagtgggtgcctaactattatggtggccgggaaaat
ttggaggctatcgctttcttgcgttacaccaataagaccattggcgttgaacgccccggc
agtgtgaccatggcggaggagtcaaccgactttcctggtgtgacattaccgcctgatatt
ggtggcctgggtttcaactataaatggaacatgggttggatgcatgacacgctgaattat
atgcaatgtgatcctgttcaccgcaaataccaccataatttgatgacgttcggtatgtta
tacgcttataccgagaactttatcttaccgctctcccacgatgaagtggtccacggcaag
cgctcgatacttgatcgtatgccgggtgatgcctggcagaaatttgccaacctacgggct
tattacgcatttatgtgggcgcatcccggtaaaaaactgctgtttatgggctgtgaattt
gcgcaggggcgtgagtggaatttcgaaaccagtctggattggcacctgctggacgatgaa
aacggctggcattccggtgtgcagcgtctggttcgtgaccttaaccattgctatcgccag
tatgcgccgttgtatgaatgggattatcaacccgctggttttgaatggttggtggttgat
gaccacgaaaattcggtattcgccttcctgcgccgtgatgccgaggggcacgaactgatt
gctatcagtaatttcaccccggttccacgttatcactaccgtgtgggcattccacaaggt
ggtcactaccgtgaagtgttgaattctgactctgcattttactgcggcagtaacctgggt
aatcagggcggcattgatagccatcatgtgaggagccacaaccacgagcattcgttgtta
ctcaccttgccaccgctggcaacgatttacctgctgcgggagaactag

DBGET integrated database retrieval system