KEGG   Yersinia pestis Z176003: YPZ3_2316Help
Entry
YPZ3_2316         CDS       T01210                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3003530..3005194)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLELKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLYNAAHTHILAVNGEIYNHQALRQQYSDRYAFQTGSDCEVILALYQEKGPAFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDYDHVKDNVTDKIQLANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDNERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPGSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcttagagcttaaaaccgaccctattgaattacgcaagaaa
gcgctagaaatgtcacgtttgatgcgtcaccgtggcccagactggtctggtgtctgggcg
aatgataaagccatcctcgcccatgagcgcttatctattgttgacgtcaataccggtgcc
cagccgctgtataatgccgcccacacacatatcttggccgtgaatggtgaaatttataat
catcaagcattacgtcagcaatatagcgaccgttacgccttccaaacgggttcagactgt
gaagttattctggcgttgtatcaagaaaaagggcccgcgttcctcgatgatctgcaaggg
atgtttgccttcgtcctatacgataccgagaaagacgcctacctgatcggccgtgaccat
ttaggtattatcccgctgtatatggggcacgacgaacacggcaatatgtttgtagcttcg
gaaatgaaagccttggtacccgtttgccgcaccataaaagaattccctgctggcagctat
ttgtggagtcaggatggcgagatccgcgaatactatcatcgcgattggtttgattacgac
cacgtcaaagacaacgtaaccgacaaaatccaacttgccaacgcattggaagatgcggtt
aaaagccatctgatgtccgatgtcccttatggggtattgctgtctggtggcctggattca
tccgttatctctgctatcaccaaaaaatttgccgcccgccgtgtagaagataatgaacgc
agcgaagcctggtggccacaactgcactccttcgccgtcggtttgattggctcacccgat
ttacgcgcagcacaagaagtcgctaaccacttgggcacggtacaccatgaaattcatttc
accgtgcaggaagggctggatgccatccgcgatgtgatttatcacatcgaaacctatgat
gtgacgactatccgcgcgtcaacgccgatgtacctgatgtcacgtaaaatcaaagccatg
ggcatcaaaatggtgctatctggtgagggttctgacgaagtcttcggtgggtatctctat
ttccacaaagcgcccaacgccaaagaattacatgaagaaaccgtgcgtaaactgttagct
ctccatatgtatgactgcgcccgtgccaacaaagcgatgtcagcttggggcgttgaagct
cgtgtgcccttcctggataaaaacttccttgatgtcgccatgcgtatcaatccacaggat
aaaatgtgcggcaatggcaaaatggagaaacatatcctgcgagaatgtttcgaatcttac
ctgccacacagcgtcgcctggcgtcagaaagaacaattctctgatggtgttggctatagc
tggattgacaccttgaaagagaaagcagccgagcaagtcactgaccaacagatggaaacc
gctcacttccgcttcccgtacaacacacctggctcgaaagaagggtatttgtaccgtgaa
atctttgaagagctgttcccgctacctagtgcggcggaatgtgtccctggcggcccctct
gttgcctgttcatcagctaaagccattgaatgggatgaatcattcaaaaatatggatgat
ccatcaggccgtgcggttggcgtccatcaggatgcttacaaataa

DBGET integrated database retrieval system